ES1 protein homolog Recombinant Protein | C21orf33 recombinant protein

Recombinant Human ES1 protein homolog, mitochondrial

Cat. Num. AAA717232

• Gene Names: C21orf33; ES1; HES1; KNPH; KNPI; GT335
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ES1 protein homolog; Recombinant Human ES1 protein homolog; mitochondrial; Protein GT335; Protein KNP-I; C21orf33 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 43-268aa; Full Length
• Sequence: ARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
• Sequence Length: 268

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Product Categories/Family for C21orf33 recombinant protein

Metabolism

References

Isolation of cDNA for a novel human protein KNP-I that is homologous to the E. coli SCRP-27A protein from the autoimmune polyglandular disease type I (APECED) region of chromosome 21q22.3.Nagamine K., Kudoh J., Minoshima S., Kawasaki K., Asakawa S., Ito F., Shimizu N.Biochem. Biophys. Res. Commun. 225:608-616(1996) Isolation and characterization of GT335, a novel human gene conserved in Escherichia coli and mapping to 21q22.3.Lafreniere R.G., Rochefort D.L., Kibar Z., Fon E.A., Han F.-Y., Cochius J., Kang X., Baird S., Korneluk R.G., Andermann E., Rommens J.M., Rouleau G.A.Genomics 38:264-272(1996) Isolation of a human gene (HES1) with homology to an Escherichia coli and a zebrafish protein that maps to chromosome 21q22.3.Scott H.S., Chen H., Rossier C., Lalioti M.D., Antonarakis S.E.Hum. Genet. 99:616-623(1997) The DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A., Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000) Genomic organization and complete nucleotide sequence of the human PWP2 gene on chromosome 21.Nagamine K., Kudoh J., Minoshima S., Kawasaki K., Asakawa S., Ito F., Shimizu N.Genomics 42:528-531(1997) Lubec G., Vishwanath V.Human liver protein map a reference database established by microsequencing and gel comparison.Hochstrasser D.F., Frutiger S., Paquet N., Bairoch A., Ravier F., Pasquali C., Sanchez J.-C., Tissot J.-D., Bjellqvist B., Vargas R., Appel R.D., Hughes G.J.Electrophoresis 13:992-1001(1992) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 296531406
• NCBI GeneID: 8209
• NCBI Accession #: NP_004640.3
• NCBI GenBank Nucleotide #: NM_004649.6
• UniProt Accession #: P30042; O00650; O00660; O15011; O15012; P55346; P78474; Q92505; Q92507; A6NFJ6; A6NJY7
• Molecular Weight: 50.9 kDa
• NCBI Official Full Name: ES1 protein homolog, mitochondrial isoform Ia
• NCBI Official Synonym Full Names: chromosome 21 open reading frame 33
• NCBI Official Symbol: C21orf33
• NCBI Official Synonym Symbols: ES1; HES1; KNPH; KNPI; GT335
• NCBI Protein Information: ES1 protein homolog, mitochondrial
• UniProt Protein Name: ES1 protein homolog, mitochondrial
• Protein Family: ES1 protein
• UniProt Gene Name: C21orf33
• UniProt Synonym Gene Names: HES1; KNPI
• UniProt Entry Name: ES1_HUMAN

NCBI Description

This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]

Uniprot Description

C21orf33: a mitochondrial protein. Two alternatively spliced isoforms have been described.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: mitochondrion