Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Bax inhibitor 1 (bxi1) Recombinant Protein | bxi1 recombinant protein

Recombinant Schizosaccharomyces pombe Bax inhibitor 1 (bxi1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bax inhibitor 1 (bxi1); Recombinant Schizosaccharomyces pombe Bax inhibitor 1 (bxi1); Recombinant Bax inhibitor 1 (bxi1); Bax inhibitor 1; BH3 domain-containg protein bxi1; bxi1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-266
Sequence
MPANYQSVPQDDPSVPNLAQAPPAYSEYNESATENPAVDQFKNTTPVAECAKSIRMAFLRKVYAILTAQLFVTSLFGGIFYLHPAFSFWVQMHPWFLILNFFISLVVLFGLIMKPYSYPRNYIFLFLFTALEGLTLGTAITFFSARIILEAVFITLGVFVALTAFTFQSKWDFSRLGGFLYVSLWSLILTPLIFFFVPSTPFIDMAFAGFGTLVFCGYILFDTYNILHRYSPEEFIMSSLMLYLDFINLFIRILQILGMLQNNDNN
Sequence Length
266
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,402 Da
NCBI Official Full Name
BAX inhibitor family protein Bxi1
NCBI Official Symbol
bxi1
NCBI Protein Information
BAX inhibitor family protein Bxi1
UniProt Protein Name
Bax inhibitor 1
UniProt Gene Name
bxi1
UniProt Synonym Gene Names
ybh3
UniProt Entry Name
BXI1_SCHPO

Uniprot Description

Function: Links the unfolded protein response and programmed cell death and mediates mitochondrial-dependent apoptosis. Induces cell death and disruption of the mitochondrial transmembrane potential

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity. Mitochondrion membrane; Multi-pass membrane protein

By similarity. Golgi apparatus membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein Ref.2.

Sequence similarities: Belongs to the BI1 family. LFG subfamily.

Similar Products

Product Notes

The bxi1 bxi1 (Catalog #AAA1197822) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-266. The amino acid sequence is listed below: MPANYQSVPQ DDPSVPNLAQ APPAYSEYNE SATENPAVDQ FKNTTPVAEC AKSIRMAFLR KVYAILTAQL FVTSLFGGIF YLHPAFSFWV QMHPWFLILN FFISLVVLFG LIMKPYSYPR NYIFLFLFTA LEGLTLGTAI TFFSARIILE AVFITLGVFV ALTAFTFQSK WDFSRLGGFL YVSLWSLILT PLIFFFVPST PFIDMAFAGF GTLVFCGYIL FDTYNILHRY SPEEFIMSSL MLYLDFINLF IRILQILGML QNNDNN. It is sometimes possible for the material contained within the vial of "Bax inhibitor 1 (bxi1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.