Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Basigin Recombinant Protein | Bsg recombinant protein

Basigin

Gene Names
Bsg; HT-7; CD147; EMMPRIN; AI115436; AI325119
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Basigin; Bsg recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
22-389. Full length of the mature protein.
Sequence
AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT
Sequence Length
389
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Bsg recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Bsg recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,674 Da
NCBI Official Full Name
basigin isoform 2
NCBI Official Synonym Full Names
basigin
NCBI Official Symbol
Bsg
NCBI Official Synonym Symbols
HT-7; CD147; EMMPRIN; AI115436; AI325119
NCBI Protein Information
basigin
UniProt Protein Name
Basigin
Protein Family
UniProt Gene Name
Bsg
UniProt Entry Name
BASI_MOUSE

Uniprot Description

BSG: Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). May target monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to plasma membranes of retinal pigment epithelium and neural retina. Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes. Enriched on the surface of tumor cells. Up-regulated in gliomas. Its expression levels correlate with malignant potential of the tumor. Forms homooligomers in a cis-dependent manner on the plasma membrane. Forms a complex with MMP1 at the tumor cell surface. Interacts with SLC16A1 and SLC1A3; probably a BSG dimer is associated with a monocarboxylate transporter dimer. Interacts with ATP1B2, MAG and L1CAM. Interacts with AJAP1. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Cellular Component: acrosomal membrane; cell; focal adhesion; integral to plasma membrane; intracellular; lipid raft; membrane; mitochondrion; plasma membrane; sarcolemma

Research Articles on Bsg

Similar Products

Product Notes

The Bsg bsg (Catalog #AAA7042365) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-389. Full length of the mature protein. The amino acid sequence is listed below: AAGFLKAPLS QERWAGGSVV LHCEAVGSPI PEIQWWFEGN APNDSCSQLW DGARLDRVHI HAAYRQHAAS SLSVDGLTAE DTGTYECRAS SDPDRNHLTR PPRVKWVRAQ ASVVVLEPGT IQTSVQEVNS KTQLTCSLNS SGVDIVGHRW MRGGKVLQED TLPDLHTKYI VDADDRSGEY SCIFLPEPVG RSEINVEGPP RIKVGKKSEH SSEGELAKLV CKSDASYPPI TDWFWFKTSD TGEEEAITNS TEANGKYVVV STPEKSQLTI SNLDVNVDPG TYVCNATNAQ GTTRETISLR VRSRMAALWP FLGIVAEVLV LVTIIFIYEK RRKPDQTLDE DDPGAAPLKG SGTHMNDKDK NVRQRNAT . It is sometimes possible for the material contained within the vial of "Basigin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.