Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Bombesin receptor subtype-3 (Brs3) Recombinant Protein | Brs3 recombinant protein

Recombinant Mouse Bombesin receptor subtype-3 (Brs3)

Gene Names
Brs3; BRS-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bombesin receptor subtype-3 (Brs3); Recombinant Mouse Bombesin receptor subtype-3 (Brs3); Recombinant Bombesin receptor subtype-3 (Brs3); Bombesin receptor subtype-3; BRS-3; Brs3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-399
Sequence
MSQRQSQSPNQTLISITNDTETSSSVVSNDTTHKGWTGDNSPGIEALCAIYITYAGIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGKVGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPPNAILKTCAKAGGIWIVSMIFALPEAIFSNVYTFQDPNRNVTFESCNSYPISERLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIAKTVLVLVALFALCWLPNHLLYLYHSFTYESYANHSDVPFVIIIFSRVLAFSNSCVNPFALYWLSKTFQQHFKAQLCCLKAEQPEPPLGDIPLNNLTVMGRVPATGSAHVSEISVTLFSGSSAKKGEDKV
Sequence Length
399
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,229 Da
NCBI Official Full Name
bombesin receptor subtype-3
NCBI Official Synonym Full Names
bombesin-like receptor 3
NCBI Official Symbol
Brs3
NCBI Official Synonym Symbols
BRS-3
NCBI Protein Information
bombesin receptor subtype-3
UniProt Protein Name
Bombesin receptor subtype-3
Protein Family
UniProt Gene Name
Brs3
UniProt Synonym Gene Names
BRS-3
UniProt Entry Name
BRS3_MOUSE

Uniprot Description

BRS3: Role in sperm cell division, maturation, or function. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: neuron projection; membrane; cell soma; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; signal transducer activity; bombesin receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; bombesin receptor signaling pathway; signal transduction

Research Articles on Brs3

Similar Products

Product Notes

The Brs3 brs3 (Catalog #AAA1253647) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-399. The amino acid sequence is listed below: MSQRQSQSPN QTLISITNDT ETSSSVVSND TTHKGWTGDN SPGIEALCAI YITYAGIISV GILGNAILIK VFFKTKSMQT VPNIFITSLA FGDLLLLLTC VPVDATHYLA EGWLFGKVGC KVLSFIRLTS VGVSVFTLTI LSADRYKAVV KPLERQPPNA ILKTCAKAGG IWIVSMIFAL PEAIFSNVYT FQDPNRNVTF ESCNSYPISE RLLQEIHSLL CFLVFYIIPL SIISVYYSLI ARTLYKSTLN IPTEEQSHAR KQIESRKRIA KTVLVLVALF ALCWLPNHLL YLYHSFTYES YANHSDVPFV IIIFSRVLAF SNSCVNPFAL YWLSKTFQQH FKAQLCCLKA EQPEPPLGDI PLNNLTVMGR VPATGSAHVS EISVTLFSGS SAKKGEDKV. It is sometimes possible for the material contained within the vial of "Bombesin receptor subtype-3 (Brs3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.