Blue-sensitive opsin Recombinant Protein | LOC396525 recombinant protein
Recombinant Chicken Blue-sensitive opsin
Gene Names
LOC396525; CHK-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Blue-sensitive opsin; Recombinant Chicken Blue-sensitive opsin; Recombinant Blue-sensitive opsin; Blue cone photoreceptor pigment; LOC396525 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-361
Sequence
MHPPRPTTDLPEDFYIPMALDAPNITALSPFLVPQTHLGSPGLFRAMAAFMFLLIALGVPINTLTIFCTARFRKLRSHLNYILVNLALANLLVILVGSTTACYSFSQMYFALGPTACKIEGFAATLGGMVSLWSLAVVAFERFLVICKPLGNFTFRGSHAVLGCVATWVLGFVASAPPLFGWSRYIPEGLQCSCGPDWYTTDNKWHNESYVLFLFTFCFGVPLAIIVFSYGRLLITLRAVARQQEQSATTQKADREVTKMVVVMVLGFLVCWAPYTAFALWVVTHRGRSFEVGLASIPSVFSKSSTVYNPVIYVLMNKQFRSCMLKLLFCGRSPFGDDEDVSGSSQATQVSSVSSSHVAPA
Sequence Length
361
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,657 Da
NCBI Official Full Name
blue-sensitive opsin
NCBI Official Symbol
LOC396525
NCBI Official Synonym Symbols
CHK-2
NCBI Protein Information
blue-sensitive opsin; opsin CHK-2; blue cone photoreceptor pigment
UniProt Protein Name
Blue-sensitive opsin
Protein Family
UniProt Entry Name
OPSB_CHICK
Uniprot Description
Function: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular location: Membrane; Multi-pass membrane protein.
Tissue specificity: The color pigments are found in the cone photoreceptor cells.
Post-translational modification: Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region.
Sequence similarities: Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.
Biophysicochemical propertiesAbsorption:Abs(max)=455 nm
Research Articles on LOC396525
Similar Products
Product Notes
The LOC396525 (Catalog #AAA1240464) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-361. The amino acid sequence is listed below: MHPPRPTTDL PEDFYIPMAL DAPNITALSP FLVPQTHLGS PGLFRAMAAF MFLLIALGVP INTLTIFCTA RFRKLRSHLN YILVNLALAN LLVILVGSTT ACYSFSQMYF ALGPTACKIE GFAATLGGMV SLWSLAVVAF ERFLVICKPL GNFTFRGSHA VLGCVATWVL GFVASAPPLF GWSRYIPEGL QCSCGPDWYT TDNKWHNESY VLFLFTFCFG VPLAIIVFSY GRLLITLRAV ARQQEQSATT QKADREVTKM VVVMVLGFLV CWAPYTAFAL WVVTHRGRSF EVGLASIPSV FSKSSTVYNP VIYVLMNKQF RSCMLKLLFC GRSPFGDDED VSGSSQATQV SSVSSSHVAP A. It is sometimes possible for the material contained within the vial of "Blue-sensitive opsin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
