Biglycan (BGN) Recombinant Protein | BGN recombinant protein

Recombinant Human Biglycan (BGN)

Cat. Num. AAA953949

• Gene Names: BGN; PGI; DSPG1; PG-S1; SLRR1A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Biglycan (BGN); Recombinant Human Biglycan (BGN); Biglycan; Bone/cartilage proteoglycan I; PG-S1; BGN recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 38-368. Full Length of Mature Protein
• Sequence: DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for BGN recombinant protein

May be involved in collagen fiber assembly.

Product Categories/Family for BGN recombinant protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 4502403
• NCBI GeneID: 633
• NCBI Accession #: NP_001702.1
• NCBI GenBank Nucleotide #: NM_001711.4
• UniProt Accession #: P21810; P13247; D3DWU3
• Molecular Weight: 57.2 kDa
• NCBI Official Full Name: biglycan preproprotein
• NCBI Official Synonym Full Names: biglycan
• NCBI Official Symbol: BGN
• NCBI Official Synonym Symbols: PGI; DSPG1; PG-S1; SLRR1A
• NCBI Protein Information: biglycan; biglycan proteoglycan; bone/cartilage proteoglycan I; bone/cartilage proteoglycan-I; small leucine-rich protein 1A; dermatan sulphate proteoglycan I
• UniProt Protein Name: Biglycan
• Protein Family: Biglycan
• UniProt Gene Name: BGN
• UniProt Synonym Gene Names: SLRR1A
• UniProt Entry Name: PGS1_HUMAN

NCBI Description

The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein plays a role in assembly of collagen fibrils and muscle regeneration. It interacts with several proteins involved in muscular dystrophy, including alpha-dystroglycan, alpha- and gamma-sarcoglycan and collagen VI, and it is critical for the assembly of the dystrophin-associated protein complex. [provided by RefSeq, Nov 2009]

Uniprot Description

BGN: May be involved in collagen fiber assembly. Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: extracellular matrix; proteinaceous extracellular matrix; lysosomal lumen; transport vesicle; cell surface; Golgi lumen; extracellular region; sarcolemma

Molecular Function: glycosaminoglycan binding; extracellular matrix binding; extracellular matrix structural constituent

Biological Process: chondroitin sulfate metabolic process; extracellular matrix organization and biogenesis; chondroitin sulfate biosynthetic process; glycosaminoglycan metabolic process; carbohydrate metabolic process; chondroitin sulfate catabolic process; blood vessel remodeling; pathogenesis; peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan; dermatan sulfate biosynthetic process