Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Serine/threonine-protein kinase BGLF4 (BGLF4) Recombinant Protein | BGLF4 recombinant protein

Recombinant Epstein-Barr virus Serine/threonine-protein kinase BGLF4 (BGLF4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein kinase BGLF4 (BGLF4); Recombinant Epstein-Barr virus Serine/threonine-protein kinase BGLF4 (BGLF4); BGLF4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-429, Full length protein
Sequence
MDVNMAAELSPTNSSSSGELSVSPEPPRETQAFLGKVTVIDYFTFQHKHLKVTNIDDMTETLYVKLPENMTRCDHLPITCEYLLGRGSYGAVYAHADNATVKLYDSVTELYHELMVCDMIQIGKATAEDGQDKALVDYLSACTSCHALFMPQFRCSLQDYGHWHDGSIEPLVRGFQGLKDAVYFLNRHCGLFHSDISPSNILVDFTDTMWGMGRLVLTDYGTASLHDRNKMLDVRLKSSKGRQLYRLYCQREPFSIAKDTYKPLCLLSKCYILRGAGHIPDPSACGPVGAQTALRLDLQSLGYSLLYGIMHLADSTHKIPYPNPDMGFDRSDPLYFLQFAAPKVVLLEVLSQMWNLNLDMGLTSCGESPCVDVTAEHMSQFLQWCRSLKKRFKESYFFNCRPRFEHPHLPGLVAELLADDFFGPDGRRG
Sequence Length
429
Species
Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,351 Da
NCBI Official Full Name
BGLF4
NCBI Official Symbol
HHV4tp2_gp47
NCBI Protein Information
serine-threonine protein kinase
UniProt Protein Name
Serine/threonine-protein kinase BGLF4
UniProt Gene Name
BGLF4

Uniprot Description

Plays many key roles by phosphorylating several proteins including the viral DNA processivity factor BMRF1, EBNA1 or EBNA2. Modifies the host nuclear envelope structure and induces the redistribution of nuclear envelope-associated proteins by phosphorylating host nucleoporins. Subsequently, promotes the nuclear transport of EBV lytic proteins. Required for efficient lytic DNA replication and release of nucleocapsids from the nucleus. Contributes to the compaction of host cell chromatin in cells undergoing lytic replication, presumably by phosphorylating the host condensin complex and host TOP2A. Induces disassembly of the nuclear lamina by phosphorylating with host LMNA. Phosphorylates substrates involved in capsid assembly and DNA packaging. Facilitates the switch from latent to lytic DNA replication by down-regulating EBNA1 replication function. Phosphorylates the viral immediate-early protein BZLF1 and inhibits its sumoylation by interacting with host SUMO1 and SUMO2.

Similar Products

Product Notes

The BGLF4 bglf4 (Catalog #AAA1044617) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-429, Full length protein. The amino acid sequence is listed below: MDVNMAAELS PTNSSSSGEL SVSPEPPRET QAFLGKVTVI DYFTFQHKHL KVTNIDDMTE TLYVKLPENM TRCDHLPITC EYLLGRGSYG AVYAHADNAT VKLYDSVTEL YHELMVCDMI QIGKATAEDG QDKALVDYLS ACTSCHALFM PQFRCSLQDY GHWHDGSIEP LVRGFQGLKD AVYFLNRHCG LFHSDISPSN ILVDFTDTMW GMGRLVLTDY GTASLHDRNK MLDVRLKSSK GRQLYRLYCQ REPFSIAKDT YKPLCLLSKC YILRGAGHIP DPSACGPVGA QTALRLDLQS LGYSLLYGIM HLADSTHKIP YPNPDMGFDR SDPLYFLQFA APKVVLLEVL SQMWNLNLDM GLTSCGESPC VDVTAEHMSQ FLQWCRSLKK RFKESYFFNC RPRFEHPHLP GLVAELLADD FFGPDGRRG. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein kinase BGLF4 (BGLF4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.