Western Blot (WB)
(Host: RabbitTarget Name: BMP8BSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit BMP8B Polyclonal Antibody | anti-BMP8B antibody
BMP8B Antibody - N-terminal region
Gene Names
BMP8B; OP2; BMP8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BMP8B; Polyclonal Antibody; BMP8B Antibody - N-terminal region; anti-BMP8B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDL
Sequence Length
349
Applicable Applications for anti-BMP8B antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 80%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human BMP8B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: BMP8BSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: BMP8BSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BMP8B antibody
This is a rabbit polyclonal antibody against BMP8B. It was validated on Western Blot
Target Description: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity.
Target Description: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity.
Product Categories/Family for anti-BMP8B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38kDa
NCBI Official Full Name
bone morphogenetic protein 8B preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 8b
NCBI Official Symbol
BMP8B
NCBI Official Synonym Symbols
OP2; BMP8
NCBI Protein Information
bone morphogenetic protein 8B
Protein Family
NCBI Description
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The encoded protein stimulates thermogenesis in brown adipose tissue. Expression of this gene may be downregulated in pancreatic cancer. This gene may have arose from a gene duplication event and its gene duplicate is also present on chromosome 1. [provided by RefSeq, Jul 2016]
Research Articles on BMP8B
Similar Products
Product Notes
The BMP8B (Catalog #AAA3216544) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMP8B Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BMP8B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BMP8B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPQRRLGARE RRDVQREILA VLGLPGRPRP RAPPAASRLP ASAPLFMLDL. It is sometimes possible for the material contained within the vial of "BMP8B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
