PTS system beta-glucoside-specific EIIBCA component (bglF) Recombinant Protein | bglF recombinant protein
Recombinant Escherichia coli PTS system beta-glucoside-specific EIIBCA component (bglF), partial
Gene Names
bglF; bglC; bglS; ECK3715; JW3700
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
PTS system beta-glucoside-specific EIIBCA component (bglF); Recombinant Escherichia coli PTS system beta-glucoside-specific EIIBCA component (bglF); partial; bglF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-625
Sequence
MTELARKIVAGVGGADNIVSLMHCATRLRFKLKDESKAQAEVLKKTPGIIMVVESGGQFQVVIGNHVADVFLAVNSVAGLDEKAQQAPENDDKGNLLNRFVYVISGIFTPLIGLMAATGILKGMLALALTFQWTTEQSGTYLILFSASDALFWFFPIILGYTAGKRFGGNPFTAMVIGGALVHPLILTAFENGQKADALGLDFLGIPVTLLNYSSSVIPIIFSAWLCSILERRLNAWLPSAIKNFFTPLLCLMVITPVTFLLVGPLSTWISELIAAGYLWLYQAVPAFAGAVMGGFWQIFVMFGLHWGLVPLCINNFTVLGYDTMIPLLMPAIMAQVGAALGVFLCERDAQKKVVAGSAALTSLFGITEPAVYGVNLPRKYPFVIACISGALGATIIGYAQTKVYSFGLPSIFTFMQTIPSTGIDFTVWASVIGGVIAIGCAFVGTVMLHFITAKRQPAQGAPQEKTPEVITPPEQGGICSPMTGEIVPLIHVADTTFASGLLGKGIAILPSVGEVRSPVAGRIASLFATLHAIGIESDDGVEILIHVGIDTVKLDGKFFSAHVNVGDKVNTGDRLISFDIPAIREAGFDLTTPVLISNSDDFTDVLPHGTAQISAGEPLLSIIR
Sequence Length
625
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66,483 Da
NCBI Official Full Name
fused beta-glucoside-specific PTS enzymes: IIA component/IIB component/IIC component
NCBI Official Symbol
bglF
NCBI Official Synonym Symbols
bglC; bglS; ECK3715; JW3700
NCBI Protein Information
fused beta-glucoside-specific PTS enzymes: IIA component/IIB component/IIC component
UniProt Protein Name
PTS system beta-glucoside-specific EIIBCA component
Protein Family
UniProt Gene Name
bglF
UniProt Synonym Gene Names
bglC; bglS; EII-Bgl
NCBI Description
bglF is part of the cryptic bglGFBH operon. [More information is available at EcoGene: EG10115]. BglF contains the PTS Enzyme IIA, IIB and IIC domains of the cryptic aromatic -glucoside PTS transporter. [More information is available at EcoCyc: EG10115].
Uniprot Description
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in beta-glucoside transport.
Research Articles on bglF
Similar Products
Product Notes
The bglF bglf (Catalog #AAA1013810) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-625. The amino acid sequence is listed below: MTELARKIVA GVGGADNIVS LMHCATRLRF KLKDESKAQA EVLKKTPGII MVVESGGQFQ VVIGNHVADV FLAVNSVAGL DEKAQQAPEN DDKGNLLNRF VYVISGIFTP LIGLMAATGI LKGMLALALT FQWTTEQSGT YLILFSASDA LFWFFPIILG YTAGKRFGGN PFTAMVIGGA LVHPLILTAF ENGQKADALG LDFLGIPVTL LNYSSSVIPI IFSAWLCSIL ERRLNAWLPS AIKNFFTPLL CLMVITPVTF LLVGPLSTWI SELIAAGYLW LYQAVPAFAG AVMGGFWQIF VMFGLHWGLV PLCINNFTVL GYDTMIPLLM PAIMAQVGAA LGVFLCERDA QKKVVAGSAA LTSLFGITEP AVYGVNLPRK YPFVIACISG ALGATIIGYA QTKVYSFGLP SIFTFMQTIP STGIDFTVWA SVIGGVIAIG CAFVGTVMLH FITAKRQPAQ GAPQEKTPEV ITPPEQGGIC SPMTGEIVPL IHVADTTFAS GLLGKGIAIL PSVGEVRSPV AGRIASLFAT LHAIGIESDD GVEILIHVGI DTVKLDGKFF SAHVNVGDKV NTGDRLISFD IPAIREAGFD LTTPVLISNS DDFTDVLPHG TAQISAGEPL LSIIR. It is sometimes possible for the material contained within the vial of "PTS system beta-glucoside-specific EIIBCA component (bglF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
