Mouse anti-Human, Rat CAPNS1 Monoclonal Antibody | anti-CAPNS1 antibody

CAPNS1 (Calpain Small Subunit 1, CSS1, Calcium-activated Neutral Proteinase Small Subunit, CANP Small Subunit, Calcium-dependent Protease Small Subunit, CDPS, Calcium-dependent Protease Small Subunit 1, Calpain Regulatory Subunit, CAPN4, CAPNS) APC

Cat. Num. AAA6135662

• Gene Names: CAPNS1; CANP; CDPS; CSS1; CANPS; CAPN4; CALPAIN4
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CAPNS1; Monoclonal Antibody; CAPNS1 (Calpain Small Subunit 1; CSS1; Calcium-activated Neutral Proteinase Small Subunit; CANP Small Subunit; Calcium-dependent Protease Small Subunit; CDPS; Calcium-dependent Protease Small Subunit 1; Calpain Regulatory Subunit; CAPN4; CAPNS) APC; anti-CAPNS1 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C4
• Specificity: Recognizes human CAPNS1. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CAPNS1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 20ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa172-260 from human CAPNS1 (AAH00592) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CAPNS1 expression in PC-12 cells using antibody.)

Western Blot (WB)

(Western Blot analysis of CAPNS1 expression in transfected 293T cell line using antibody : Lane 1: CAPNS1 transfected lysate (28.3kD) Lane 2: Non-transfected lysate)

Immunohistochemistry (IHC)

(Immunoperoxidase staining of CAPNS1 on formalin-fixed paraffin-embedded human kidney using antibody at 3ug/ml.)

Immunofluorescence (IF)

(Immunofluorescence staining of CAPNS1 on HeLa cells using antibody at 20ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged CAPNS1 is ~0.1ng/ml when antibody was used as capture antibody.)

Western Blot (WB)

(Western blot analysis of CAPNS1 over-expressed 293 cell line, cotransfected with CAPNS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPNS1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(CAPNS1 monoclonal antibody, Western Blot analysis of CAPNS1 expression in A-431.)

Product Categories/Family for anti-CAPNS1 antibody

Antibodies; Calpain

References

1. Overexpression of a Minimal Domain of Calpastatin Suppresses IL-6 Production and Th17 Development via Reduced NF-kB and Increased STAT5 Signals. Iguchi-Hashimoto M, Usui T, Yoshifuji H, Shimizu M, Kobayashi S, Ito Y, Murakami K, Shiomi A, Yukawa N, Kawabata D, Nojima T, Ohmura K, Fujii T, Mimori T.PLoS One. 2011;6(10):e27020. Epub 2011 Oct 27. 2. The calpain inhibitor calpeptin prevents bleomycin-induced pulmonary fibrosis in mice. Tabata C, Tabata R, Nakano T.Clin Exp Immunol. 2010 Sep 15. doi: 10.1111/j.1365-2249.2010.04257.x. 3. Vitamin E and C supplementation does not ameliorate muscle dysfunction following anterior cruciate ligament surgery. Barker T, Leonard SW, Hansen J, Trawick RH, Ingram R, Burdett G, Lebold KM, Walker JA, Traber MG.Free Radic Biol Med. 2009 Sep 11.

NCBI and Uniprot Product Information

• NCBI GI #: 33875613
• NCBI GeneID: 826
• Molecular Weight: 28,316 Da
• NCBI Official Full Name: Homo sapiens calpain, small subunit 1, mRNA
• NCBI Official Synonym Full Names: calpain small subunit 1
• NCBI Official Symbol: CAPNS1
• NCBI Official Synonym Symbols: CANP; CDPS; CSS1; CANPS; CAPN4; CALPAIN4
• NCBI Protein Information: calpain small subunit 1
• Protein Family: Calpain

NCBI Description

This gene is a member of the calpain small subunit family. Calpains are calcium-dependent cysteine proteinases that are widely distributed in mammalian cells. Calpains operate as heterodimers, comprising a specific large catalytic subunit (calpain 1 subunit in Calpain I, and calpain 2 subunit in Calpain II), and a common small regulatory subunit encoded by this gene. This encoded protein is essential for the stability and function of both calpain heterodimers, whose proteolytic activities influence various cellular functions including apoptosis, proliferation, migration, adhesion, and autophagy. Calpains have been implicated in neurodegenerative processes, such as myotonic dystrophy. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]