Bestrophin-2 (Best2) Recombinant Protein | Best2 recombinant protein
Recombinant Mouse Bestrophin-2 (Best2)
Gene Names
Best2; Vmd2l1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bestrophin-2 (Best2); Recombinant Mouse Bestrophin-2 (Best2); Best2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-508aa; full length protein
Sequence
MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKR YFEKLVIYCDQYASLIPVSFVLGFYVTLVVHRWWNQYLCMPLPDALMCIVAGTVHGRDDR GRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNK YWVPCVWFSSLAAQARREGRIRDNSALKLLLEELNVFRSKCGMLFHYDWISIPLVYTQVV TIAVYSYFLACLIGRQFLDPAQGYKDHTLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGE DDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDAAEARAPYTAATAFLLQQPSF QGSTFDIALAKEDMQFQRLDGVDGPLGEVHGDFLQRLLPAGAGSVGPLGRRLSLLRRKNS CVSEASTAASCGCAGAADGGGVECGCGDPLLDPSLREPELEPPACPEPPAPIPGPTPEPF TTVSIPGPRAPAPPWLPSPIGEEEESPA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Best2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,023 Da
NCBI Official Full Name
bestrophin-2
NCBI Official Synonym Full Names
bestrophin 2
NCBI Official Symbol
Best2
NCBI Official Synonym Symbols
Vmd2l1
NCBI Protein Information
bestrophin-2
UniProt Protein Name
Bestrophin-2
Protein Family
UniProt Gene Name
Best2
UniProt Synonym Gene Names
Vmd2l1
UniProt Entry Name
BEST2_MOUSE
Uniprot Description
BEST2: Forms calcium-sensitive chloride channels. Permeable to bicarbonate. Belongs to the bestrophin family.
Protein type: Membrane protein, integral; Transporter; Transporter, ion channel; Membrane protein, multi-pass
Cellular Component: cilium; integral to membrane; integral to plasma membrane; membrane; plasma membrane
Molecular Function: chloride channel activity
Biological Process: chloride transport; ion transport; membrane depolarization; transport
Research Articles on Best2
Similar Products
Product Notes
The Best2 best2 (Catalog #AAA7010376) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-508aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Best2 best2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTVTYTARVA NARFGGFSQL LLLWRGSIYK LLWRELLCFL GLYMALSAAY RFLLAEEQKR YFEKLVIYCD QYASLIPVSF VLGFYVTLVV HRWWNQYLCM PLPDALMCIV AGTVHGRDDR GRLYRRTLMR YAGLSAVLIL RSVSTAVFKR FPTIDHVVEA GFMTREERKK FENLNSSYNK YWVPCVWFSS LAAQARREGR IRDNSALKLL LEELNVFRSK CGMLFHYDWI SIPLVYTQVV TIAVYSYFLA CLIGRQFLDP AQGYKDHTLD LCVPIFTLLQ FFFYAGWLKV AEQLINPFGE DDDDFETNFL IDRNFQVSML AVDEMYDDLA MLEKDLYWDA AEARAPYTAA TAFLLQQPSF QGSTFDIALA KEDMQFQRLD GVDGPLGEVH GDFLQRLLPA GAGSVGPLGR RLSLLRRKNS CVSEASTAAS CGCAGAADGG GVECGCGDPL LDPSLREPEL EPPACPEPPA PIPGPTPEPF TTVSIPGPRA PAPPWLPSPI GEEEESPA. It is sometimes possible for the material contained within the vial of "Bestrophin-2 (Best2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
