B-cell CLL/lymphoma 7 protein family member B (BCL7B) Recombinant Protein | BCL7B recombinant protein
Recombinant Bovine B-cell CLL/lymphoma 7 protein family member B (BCL7B)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
B-cell CLL/lymphoma 7 protein family member B (BCL7B); Recombinant Bovine B-cell CLL/lymphoma 7 protein family member B (BCL7B); BCL7B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-202, full length protein
Sequence
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPASEVADEPPTLTKEEPVPLETQIAEEEEDSSAPPLKRFCMDQPAVPQTASES
Sequence Length
202
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for BCL7B recombinant protein
This protein contains a region that is highly similar to the N-terminal segment of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. The function of this gene has not yet been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,197 Da
NCBI Official Full Name
B-cell CLL/lymphoma 7 protein family member B
NCBI Official Synonym Full Names
BCL tumor suppressor 7B
NCBI Official Symbol
BCL7B
NCBI Protein Information
B-cell CLL/lymphoma 7 protein family member B
UniProt Protein Name
B-cell CLL/lymphoma 7 protein family member B
Protein Family
UniProt Gene Name
BCL7B
Uniprot Description
Positive regulator of apoptosis. Plays a role in the Wnt signaling pathway, negatively regulating the expression of Wnt signaling components CTNNB1 and HMGA1. Involved in cell cycle progression, maintenance of the nuclear structure and stem cell differentiation. May play a role in lung tumor development or progression.
Similar Products
Product Notes
The BCL7B bcl7b (Catalog #AAA1398764) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-202, full length protein. The amino acid sequence is listed below: MSGRSVRAET RSRAKDDIKK VMAAIEKVRK WEKKWVTVGD TSLRIFKWVP VTDSKEKEKS KSNSSAAREP NGFPSDASAN SSLLLEFQDE NSNQSSVSDV YQLKVDSSTN SSPSPQQSES LSPAHTSDFR TDDSQPPTLG QEILEEPSLP ASEVADEPPT LTKEEPVPLE TQIAEEEEDS SAPPLKRFCM DQPAVPQTAS ES. It is sometimes possible for the material contained within the vial of "B-cell CLL/lymphoma 7 protein family member B (BCL7B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
