Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Apoptosis regulator Bcl-2 (Bcl2) Recombinant Protein | Bcl2 recombinant protein

Recombinant Rat Apoptosis regulator Bcl-2 (Bcl2)

Gene Names
Bcl2; Bcl-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apoptosis regulator Bcl-2 (Bcl2); Recombinant Rat Apoptosis regulator Bcl-2 (Bcl2); Bcl2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-236aa; Full length protein
Sequence
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPA VHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Bcl2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,622 Da
NCBI Official Full Name
apoptosis regulator Bcl-2
NCBI Official Synonym Full Names
B-cell CLL/lymphoma 2
NCBI Official Symbol
Bcl2
NCBI Official Synonym Symbols
Bcl-2
NCBI Protein Information
apoptosis regulator Bcl-2
UniProt Protein Name
Apoptosis regulator Bcl-2
Protein Family
UniProt Gene Name
Bcl2
UniProt Synonym Gene Names
Bcl-2
UniProt Entry Name
BCL2_RAT

NCBI Description

an anti-apoptotic protein; involved in inhibiting cell death in many different cell types [RGD, Feb 2006]

Uniprot Description

Bcl-2: a antiapoptotic member of the Bcl-2 family. Regulates cell death by controlling the mitochondrial membrane permeability. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Phosphorylation by JNKs may increase its antiapoptotic functions.

Protein type: Oncoprotein; Apoptosis; Autophagy; Membrane protein, integral

Cellular Component: cytoplasm; cytosol; endoplasmic reticulum; endoplasmic reticulum membrane; integral to membrane; intracellular; membrane; mitochondrial membrane; mitochondrial outer membrane; mitochondrion; myelin sheath; nuclear membrane; nucleus; perinuclear region of cytoplasm; pore complex

Molecular Function: BH domain binding; BH3 domain binding; channel activity; channel inhibitor activity; identical protein binding; protease binding; protein binding; protein heterodimerization activity; protein homodimerization activity; protein phosphatase 2A binding; protein phosphatase binding; sequence-specific DNA binding; transcription factor binding; ubiquitin protein ligase binding

Biological Process: actin filament organization; aging; apoptosis; apoptotic mitochondrial changes; axon regeneration; axonogenesis; B cell differentiation; B cell homeostasis; B cell lineage commitment; B cell proliferation; B cell receptor signaling pathway; behavioral fear response; brain development; CD8-positive, alpha-beta T cell lineage commitment; cell aging; cell growth; cell morphogenesis; cell proliferation; cell-cell adhesion; cellular calcium ion homeostasis; cellular response to glucose starvation; cochlear nucleus development; defense response to virus; developmental growth; digestive tract morphogenesis; DNA damage response, signal transduction resulting in induction of apoptosis; ear development; endoplasmic reticulum calcium ion homeostasis; focal adhesion formation; gland morphogenesis; glomerulus development; growth; hair follicle morphogenesis; hemopoiesis; homeostasis of number of cells within a tissue; immune system development; induction of apoptosis by oxidative stress; induction of apoptosis via death domain receptors; kidney development; leukocyte homeostasis; lymphocyte homeostasis; lymphoid progenitor cell differentiation; male gonad development; melanin metabolic process; melanocyte differentiation; mesenchymal cell development; metanephros development; negative regulation of apoptosis; negative regulation of autophagy; negative regulation of cell growth; negative regulation of cell migration; negative regulation of cell proliferation; negative regulation of cellular pH reduction; negative regulation of mitotic cell cycle; negative regulation of myeloid cell apoptosis; negative regulation of neuron apoptosis; negative regulation of ossification; negative regulation of osteoblast proliferation; negative regulation of retinal cell programmed cell death; neuron apoptosis; oligodendrocyte differentiation; oocyte development; organ growth; organ morphogenesis; ossification; ovarian follicle development; peptidyl-serine phosphorylation; peptidyl-threonine phosphorylation; pigment granule organization and biogenesis; pigmentation; pigmentation during development; positive regulation of B cell proliferation; positive regulation of catalytic activity; positive regulation of cell growth; positive regulation of cell proliferation; positive regulation of melanocyte differentiation; positive regulation of multicellular organism growth; positive regulation of neuron maturation; positive regulation of peptidyl-serine phosphorylation; positive regulation of pigmentation; positive regulation of skeletal muscle fiber development; positive regulation of smooth muscle cell migration; post-embryonic development; protein amino acid dephosphorylation; protein polyubiquitination; regulation of apoptosis; regulation of autophagy; regulation of calcium ion transport; regulation of catalytic activity; regulation of cell cycle; regulation of cell-matrix adhesion; regulation of gene expression; regulation of mitochondrial membrane permeability; regulation of mitochondrial membrane potential; regulation of nitrogen utilization; regulation of pigmentation during development; regulation of programmed cell death; regulation of protein heterodimerization activity; regulation of protein homodimerization activity; regulation of protein localization; regulation of protein stability; regulation of transmembrane transporter activity; regulation of viral genome replication; release of cytochrome c from mitochondria; renal system process; response to aluminum ion; response to caffeine; response to cAMP; response to copper ion; response to corticosterone stimulus; response to cytokine stimulus; response to DNA damage stimulus; response to drug; response to electrical stimulus; response to estrogen stimulus; response to ethanol; response to folic acid; response to gamma radiation; response to glucocorticoid stimulus; response to heat; response to hydrogen peroxide; response to hypoxia; response to inorganic substance; response to insulin stimulus; response to iron ion; response to L-ascorbic acid; response to nicotine; response to nutrient; response to organic cyclic substance; response to organic substance; response to oxidative stress; response to peptide hormone stimulus; response to steroid hormone stimulus; response to toxin; response to UV-B; spleen development; T cell differentiation; T cell differentiation in the thymus; T cell homeostasis; T cell lineage commitment; thymus development; transmembrane transport; ureteric bud branching; ureteric bud development

Research Articles on Bcl2

Similar Products

Product Notes

The Bcl2 bcl2 (Catalog #AAA7010324) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-236aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Bcl2 bcl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAQAGRTGYD NREIVMKYIH YKLSQRGYEW DTGDEDSAPL RAAPTPGIFS FQPESNRTPA VHRDTAARTS PLRPLVANAG PALSPVPPVV HLTLRRAGDD FSRRYRRDFA EMSSQLHLTP FTARGRFATV VEELFRDGVN WGRIVAFFEF GGVMCVESVN REMSPLVDNI ALWMTEYLNR HLHTWIQDNG GWDAFVELYG PSMRPLFDFS WLSLKTLLSL ALVGACITLG AYLGHK. It is sometimes possible for the material contained within the vial of "Apoptosis regulator Bcl-2 (Bcl2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.