Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

B-cell lymphoma/leukemia 11B (Bcl11b) Recombinant Protein | Bcl11b recombinant protein

Recombinant Mouse B-cell lymphoma/leukemia 11B (Bcl11b) , partial

Gene Names
Bcl11b; Rit1; Ctip2; BCL-11B; AI604821; 9130430L19Rik; B630002E05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
B-cell lymphoma/leukemia 11B (Bcl11b); Recombinant Mouse B-cell lymphoma/leukemia 11B (Bcl11b); partial; Bcl11b recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
221-481. Partial
Sequence
YICTTCKQPFNSAWFLLQHAQNTHGFRIYLEPGPASTSLTPRLTIPPPLGPETVAQSPLMNFLGDSNPFNLLRMTGPILRDHPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMRLNPMAIDSPAMDFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMPAGTPPPQPPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHKAG
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Bcl11b recombinant protein
This gene encodes a C2H2-type zinc finger protein and is closely related to BCL11A, a gene whose translocation may be associated with B-cell malignancies. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,174 Da
NCBI Official Full Name
B-cell lymphoma/leukemia 11B isoform a
NCBI Official Synonym Full Names
B cell leukemia/lymphoma 11B
NCBI Official Symbol
Bcl11b
NCBI Official Synonym Symbols
Rit1; Ctip2; BCL-11B; AI604821; 9130430L19Rik; B630002E05Rik
NCBI Protein Information
B-cell lymphoma/leukemia 11B
UniProt Protein Name
B-cell lymphoma/leukemia 11B
Protein Family
UniProt Gene Name
Bcl11b
UniProt Synonym Gene Names
Ctip2; Rit1; BCL-11B; mRit1

Uniprot Description

Key regulator of both differentiation and survival of T-lymphocytes during thymocyte development in mammals (PubMed:12717433). Essential in controlling the responsiveness of hematopoietic stem cells to chemotactic signals by modulating the expression of receptors CCR7 and CCR9, which direct the movement of progenitor cells from the bone marrow to the thymus (). Is a regulator of IL2 promoter and enhances IL2 expression in activated CD4+ T-lymphocytes (PubMed:16809611). Tumor-suppressor protein involved in T-cell lymphomas. May function on the P53-signaling pathway. Repress transcription through direct, TFCOUP2-independent binding to a GC-rich response element.

Research Articles on Bcl11b

Similar Products

Product Notes

The Bcl11b bcl11b (Catalog #AAA1363409) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 221-481. Partial. The amino acid sequence is listed below: YICTTCKQPF NSAWFLLQHA QNTHGFRIYL EPGPASTSLT PRLTIPPPLG PETVAQSPLM NFLGDSNPFN LLRMTGPILR DHPGFGEGRL PGTPPLFSPP PRHHLDPHRL SAEEMGLVAQ HPSAFDRVMR LNPMAIDSPA MDFSRRLREL AGNSSTPPPV SPGRGNPMHR LLNPFQPSPK SPFLSTPPLP PMPAGTPPPQ PPAKSKSCEF CGKTFKFQSN LIVHRRSHTG EKPYKCQLCD HACSQASKLK RHMKTHMHKA G . It is sometimes possible for the material contained within the vial of "B-cell lymphoma/leukemia 11B (Bcl11b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.