Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable branched-chain-amino-acid aminotransferase 4 (BCAT4) Recombinant Protein | BCAT4 recombinant protein

Recombinant Arabidopsis thaliana Probable branched-chain-amino-acid aminotransferase 4 (BCAT4)

Gene Names
BCAT4; branched-chain aminotransferase4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable branched-chain-amino-acid aminotransferase 4 (BCAT4); Recombinant Arabidopsis thaliana Probable branched-chain-amino-acid aminotransferase 4 (BCAT4); BCAT4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-354, Full length protein
Sequence
MAPSAQPLPVSVSDEKYANVKWEELAFKFVRTDYMYVAKCNHGESFQEGKILPFADLQLNPCAAVLQYGQGLYEGLKAYRTEDGRILLFRPDQNGLRLQAGADRLYMPYPSVDQFVSAIKQVALANKKWIPPPGKGTLYIRPILFGSGPILGSFPIPETTFTAFACPVGRYHKDNSGLNLKIEDQFRRAFPSGTGGVKSITNYCPVWIPLAEAKKQGFSDILFLDAATGKNIEELFAANVFMLKGNVVSTPTIAGTILPGVTRNCVMELCRDFGYQVEERTIPLVDFLDADEAFCTGTASIVTSIASVTFKDKKTGFKTGEETLAAKLYETLSDIQTGRVEDTKGWTVEIDRQG
Sequence Length
354
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,019 Da
NCBI Official Full Name
branched-chain aminotransferase4
NCBI Official Symbol
BCAT4
NCBI Official Synonym Symbols
branched-chain aminotransferase4
NCBI Protein Information
branched-chain aminotransferase4
UniProt Protein Name
Methionine aminotransferase BCAT4
UniProt Gene Name
BCAT4
UniProt Synonym Gene Names
Atbcat-4

NCBI Description

Belongs to the branched-chain amino acid aminotransferase gene family. Encodes a methionine-oxo-acid transaminase. Involved in the methionine chain elongation pathway that leads to the ultimate biosynthesis of methionine-derived glucosinolates.

Uniprot Description

Converts 2-oxo acids to branched-chain amino acids. Shows activity with L-Leu, L-Ile and L-Val as amino donors and alpha-keto-glutarate as an amino acceptor, but no activity for D-isomers of Leu, Ile, Val, Asp, Glu or Ala. Acts on methionine and its derivatives and the corresponding 2-oxo acids. Catalyzes the initial deamination of methionine to 4-methylthio-2-oxobutyrate as well as the transamination of other typical intermediates of the methionine chain elongation pathway.

Similar Products

Product Notes

The BCAT4 bcat4 (Catalog #AAA1321107) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-354, Full length protein. The amino acid sequence is listed below: MAPSAQPLPV SVSDEKYANV KWEELAFKFV RTDYMYVAKC NHGESFQEGK ILPFADLQLN PCAAVLQYGQ GLYEGLKAYR TEDGRILLFR PDQNGLRLQA GADRLYMPYP SVDQFVSAIK QVALANKKWI PPPGKGTLYI RPILFGSGPI LGSFPIPETT FTAFACPVGR YHKDNSGLNL KIEDQFRRAF PSGTGGVKSI TNYCPVWIPL AEAKKQGFSD ILFLDAATGK NIEELFAANV FMLKGNVVST PTIAGTILPG VTRNCVMELC RDFGYQVEER TIPLVDFLDA DEAFCTGTAS IVTSIASVTF KDKKTGFKTG EETLAAKLYE TLSDIQTGRV EDTKGWTVEI DRQG. It is sometimes possible for the material contained within the vial of "Probable branched-chain-amino-acid aminotransferase 4 (BCAT4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.