Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Bromodomain adjacent to zinc finger domain protein 1A (BAZ1A) Recombinant Protein | BAZ1A recombinant protein

Recombinant Human Bromodomain adjacent to zinc finger domain protein 1A (BAZ1A) , partial

Gene Names
BAZ1A; ACF1; WALp1; hACF1; WCRF180
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bromodomain adjacent to zinc finger domain protein 1A (BAZ1A); Recombinant Human Bromodomain adjacent to zinc finger domain protein 1A (BAZ1A); partial; BAZ1A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1425-1556aa; Partial
Sequence
SSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
175,385 Da
NCBI Official Full Name
bromodomain adjacent to zinc finger domain protein 1A isoform a
NCBI Official Synonym Full Names
bromodomain adjacent to zinc finger domain 1A
NCBI Official Symbol
BAZ1A
NCBI Official Synonym Symbols
ACF1; WALp1; hACF1; WCRF180
NCBI Protein Information
bromodomain adjacent to zinc finger domain protein 1A
UniProt Protein Name
Bromodomain adjacent to zinc finger domain protein 1A
UniProt Gene Name
BAZ1A
UniProt Synonym Gene Names
ACF1; WCRF180; hACF1; WCRF180

NCBI Description

The BAZ1A gene encodes the accessory subunit of the ATP-dependent chromatin assembly factor (ACF), a member of the ISWI ('imitation switch') family of chromatin remodeling complexes (summarized by Racki et al., 2009 [PubMed 20033039]).[supplied by OMIM, Apr 2010]

Uniprot Description

Component of the ACF complex, an ATP-dependent chromatin remodeling complex, that regulates spacing of nucleosomes using ATP to generate evenly spaced nucleosomes along the chromatin. The ATPase activity of the complex is regulated by the length of flanking DNA. Also involved in facilitating the DNA replication process. BAZ1A is the accessory, non-catalytic subunit of the complex which can enhance and direct the process provided by the ATPase subunit, SMARCA5, probably through targeting pericentromeric heterochromatin in late S phase. Moves end-positioned nucleosomes to a predominantly central position. May have a role in nuclear receptor-mediated transcription repression.

Research Articles on BAZ1A

Similar Products

Product Notes

The BAZ1A baz1a (Catalog #AAA1426357) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1425-1556aa; Partial. The amino acid sequence is listed below: SSGRQGGVHE LSAFEQLVVE LVRHDDSWPF LKLVSKIQVP DYYDIIKKPI ALNIIREKVN KCEYKLASEF IDDIELMFSN CFEYNPRNTS EAKAGTRLQA FFHIQAQKLG LHVTPSNVDQ VSTPPAAKKS RI . It is sometimes possible for the material contained within the vial of "Bromodomain adjacent to zinc finger domain protein 1A (BAZ1A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.