Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence-BAZ1A Polyclonal Antibody)

Rabbit anti-Human BAZ1A Polyclonal Antibody | anti-BAZ1A antibody

BAZ1A Polyclonal Antibody

Gene Names
BAZ1A; ACF1; WALp1; hACF1; WCRF180
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
BAZ1A; Polyclonal Antibody; BAZ1A Polyclonal Antibody; ACF1; WALp1; WCRF180; hACF1; bromodomain adjacent to zinc finger domain 1A; anti-BAZ1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.47 mg/ml (varies by lot)
Sequence Length
366
Applicable Applications for anti-BAZ1A antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1347-1556 of human BAZ1A (NP_038476.2).
Immunogen Sequence
VFVELLSPRRKRRGRKSANNTPENSPNFPNFRVIATKSSEQSRSVNIASKLSLQESESKRRCRKRQSPEPSPVTLGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence-BAZ1A Polyclonal Antibody)

Immunofluorescence (IF) (Immunofluorescence-BAZ1A Polyclonal Antibody)
Related Product Information for anti-BAZ1A antibody
The BAZ1A gene encodes the accessory subunit of the ATP-dependent chromatin assembly factor (ACF), a member of the ISWI ('imitation switch') family of chromatin remodeling complexes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
175kDa; 178kDa
NCBI Official Full Name
BAZ1A protein, partial
NCBI Official Synonym Full Names
bromodomain adjacent to zinc finger domain 1A
NCBI Official Symbol
BAZ1A
NCBI Official Synonym Symbols
ACF1; WALp1; hACF1; WCRF180
NCBI Protein Information
bromodomain adjacent to zinc finger domain protein 1A
UniProt Protein Name
Bromodomain adjacent to zinc finger domain protein 1A
UniProt Gene Name
BAZ1A
UniProt Synonym Gene Names
ACF1; WCRF180; hACF1; WCRF180
UniProt Entry Name
BAZ1A_HUMAN

NCBI Description

The BAZ1A gene encodes the accessory subunit of the ATP-dependent chromatin assembly factor (ACF), a member of the ISWI ('imitation switch') family of chromatin remodeling complexes (summarized by Racki et al., 2009 [PubMed 20033039]).[supplied by OMIM, Apr 2010]

Uniprot Description

BAZ1A: Component of the ACF complex, an ATP-dependent chromatin remodeling complex, that regulates spacing of nucleosomes using ATP to generate evenly spaced nucleosomes along the chromatin. The ATPase activity of the complex is regulated by the length of flanking DNA. Also involved in facilitating the DNA replication process. BAZ1A is the accessory, non-catalytic subunit of the complex which can enhance and direct the process provided by the ATPase subunit, SMARCA5, probably through targeting pericentromeric heterochromatin in late S phase. Moves end- positioned nucleosomes to a predominantly central position. May have a role in nuclear receptor-mediated transcription repression. Component of the ACF chromatin remodeling complex that includes BAZ1A and SMARCA5. Additional this complex can form, together with CHRAC1 and POLE1, the histone-fold protein complex, CHRAC. Interacts with NCOR1 (via its RD1 domain); the interaction corepresses a number of NCOR1-regulated genes. Highly expressed in testis and at low or undetectable levels in other tissues analyzed. Belongs to the WAL family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Nuclear receptor co-regulator; Protein kinase, Ser/Thr (non-receptor); DNA replication; DNA-binding; ATYPICAL group; BAZ family

Chromosomal Location of Human Ortholog: 14q13.2

Cellular Component: nuclear chromosome; chromatin accessibility complex

Molecular Function: protein binding; histone acetyltransferase activity; zinc ion binding

Biological Process: chromatin remodeling; transcription, DNA-dependent; regulation of transcription, DNA-dependent; DNA-dependent DNA replication

Research Articles on BAZ1A

Similar Products

Product Notes

The BAZ1A baz1a (Catalog #AAA9140882) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAZ1A Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAZ1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the BAZ1A baz1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAZ1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.