Small protein A (smpA) Recombinant Protein | smpA recombinant protein

Recombinant Escherichia coli Small protein A (smpA)

Cat. Num. AAA1176724

• Gene Names: bamE; ECK2613; JW2598; smpA; smqA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Small protein A (smpA); Recombinant Escherichia coli Small protein A (smpA); smpA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-113, full length protein
• Sequence: CSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN
• Sequence Length: 94

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 90111468
• NCBI GeneID: 945583
• NCBI Accession #: NP_417107.2
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P0A937; P23089
• Molecular Weight: 12,302 Da
• NCBI Official Full Name: lipoprotein component of BamABCDE OM biogenesis complex
• NCBI Official Symbol: bamE
• NCBI Official Synonym Symbols: ECK2613; JW2598; smpA; smqA
• NCBI Protein Information: lipoprotein component of BamABCDE OM biogenesis complex
• UniProt Protein Name: Outer membrane protein assembly factor BamE
• Protein Family: 16 kDa outer membrane lipoprotein
• UniProt Gene Name: bamE

NCBI Description

smpA mutants are sensitive to rifampin, cholate, and SDS/EDTA, indicating an OM defect (Sklar, 2007). smpA bamB double mutant is non-viable (Sklar, 2007). [More information is available at EcoGene: EG10952]. SmpA is, based on sequence analysis, a lipoprotein in the outer membrane of Escherichia coli . [More information is available at EcoCyc: EG10952].

Uniprot Description

Part of the outer membrane protein assembly complex (Bam), which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Nonessential member of the complex that stabilizes the interaction between the essential proteins BamA and BamD. May modulate the conformation of BamA, likely through interactions with BamD. Efficient substrate folding and insertion into the outer membrane requires all 5 subunits (PubMed:20378773, PubMed:21823654, PubMed:27686148). A lateral gate may open between the first and last strands of the BamA beta-barrel that allows substrate to insert into the outer membrane; comparison of the structures of complete and nearly complete Bam complexes show there is considerable movement of all 5 proteins (PubMed:27686148, PubMed:26900875, PubMed:26901871, PubMed:26744406).