Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human BACE1/ASP2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 65-75 kDa.)

BACE1/ASP2 Recombinant Protein | BACE1 recombinant protein

Recombinant Human BACE1/ASP2 Protein

Gene Names
BACE1; ASP2; BACE; HSPC104
Purity
>95% by SDS-PAGE.
Synonyms
BACE1/ASP2; Recombinant Human BACE1/ASP2 Protein; ASP2; BACE; HSPC104; BACE1 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
Sequence Length
401
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
8xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human BACE1/ASP2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 65-75 kDa.)

SDS-Page (Recombinant Human BACE1/ASP2 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 65-75 kDa.)
Related Product Information for BACE1 recombinant protein
Description: Recombinant Human BACE1/ASP2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr22-Tyr460) of human BACE1/ASP2 (Accession #NP_036236.1) fused with an 8xHis tag at the C-terminus.

Background: Beta-site APP-cleaving enzyme 1 (BACE1) is an aspartic-acid protease important in the formation of myelin sheaths in peripheral nerve cells.BACE-1 is the peptidase predominantly responsible for cleavage of the amyloid precursor protein beta site in the brain to generate the amyloid beta peptide. Because the amyloid beta peptide is a major component of amyloid plaques, BACE-1 has been implicated in the onset and/or progression of Alzheimer's disease. BACE-1 is expressed in a variety of human tissues,such brain, pancreatic tissue.
Product Categories/Family for BACE1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
beta-secretase 1 isoform E
NCBI Official Synonym Full Names
beta-secretase 1
NCBI Official Symbol
BACE1
NCBI Official Synonym Symbols
ASP2; BACE; HSPC104
NCBI Protein Information
beta-secretase 1
UniProt Protein Name
Beta-secretase 1
Protein Family
UniProt Gene Name
BACE1
UniProt Synonym Gene Names
BACE; KIAA1149; ASP2; Asp 2
UniProt Entry Name
BACE1_HUMAN

NCBI Description

This gene encodes a member of the peptidase A1 family of aspartic proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protease. This transmembrane protease catalyzes the first step in the formation of amyloid beta peptide from amyloid precursor protein. Amyloid beta peptides are the main constituent of amyloid beta plaques, which accumulate in the brains of human Alzheimer's disease patients. [provided by RefSeq, Nov 2015]

Uniprot Description

BACE: an integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Cleaves APP at the amino terminus of the A-beta peptide sequence, leading to the generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated carboxy-terminal fragment which is later release by gamma-secretase. Four splice-variant isoforms have been described.

Protein type: Protease; EC 3.4.23.46; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q23.2-q23.3

Cellular Component: multivesicular body; Golgi apparatus; cell surface; cytoplasmic vesicle membrane; integral to plasma membrane; axon; endoplasmic reticulum; late endosome; integral to membrane; plasma membrane; trans-Golgi network; endosome

Molecular Function: protein binding; enzyme binding; beta-amyloid binding; beta-aspartyl-peptidase activity; aspartic-type endopeptidase activity

Biological Process: beta-amyloid metabolic process; membrane protein ectodomain proteolysis; proteolysis

Research Articles on BACE1

Similar Products

Product Notes

The BACE1 bace1 (Catalog #AAA9141766) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TGRRGDLATI HGMNRPFLLL MATPLERAQH LQSSRHRRAL DTNYCFSSTE KNCCVRQLYI. It is sometimes possible for the material contained within the vial of "BACE1/ASP2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.