Putative ataxin-7-like protein 3B (ATXN7L3B) Recombinant Protein | ATXN7L3B recombinant protein
Recombinant Human Putative ataxin-7-like protein 3B (ATXN7L3B)
Gene Names
ATXN7L3B; lnc-SCA7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative ataxin-7-like protein 3B (ATXN7L3B); Recombinant Human Putative ataxin-7-like protein 3B (ATXN7L3B); ATXN7L3B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-97, Full length protein
Sequence
MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFAETGSVKDFGIQPVEDKGACRLPLCSLPGEPGNGPDQQLQRSPPEFQ
Sequence Length
97
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,771 Da
NCBI Official Full Name
ataxin-7-like protein 3B
NCBI Official Synonym Full Names
ataxin 7 like 3B
NCBI Official Symbol
ATXN7L3B
NCBI Official Synonym Symbols
lnc-SCA7
NCBI Protein Information
ataxin-7-like protein 3B
UniProt Protein Name
Ataxin-7-like protein 3B
Protein Family
UniProt Gene Name
ATXN7L3B
Uniprot Description
By binding to ENY2, interferes with the nuclear functions of the deubiquitinase (DUB) module of the SAGA complex which consists of ENY2, ATXN7, ATXN7L3 and the histone deubiquitinating component USP22. Affects USP22 DUB activity toward histones indirectly by changing the subcellular distribution of ENY2 and altering ENY2 availability for ATXN7L3 interaction. Regulates H2B monoubiquitination (H2Bub1) levels through cytoplasmic sequestration of ENY2 resulting in loss of nuclear ENY2-ATXN7L3 association which destabilizes ATXN7L3. Affects protein expression levels of ENY2 and ATXN7L3.
Research Articles on ATXN7L3B
Similar Products
Product Notes
The ATXN7L3B atxn7l3b (Catalog #AAA1285522) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-97, Full length protein. The amino acid sequence is listed below: MEEISLANLD TNKLEAIAQE IYVDLIEDSC LGFCFEVHRA VKCGYFYLEF AETGSVKDFG IQPVEDKGAC RLPLCSLPGE PGNGPDQQLQ RSPPEFQ. It is sometimes possible for the material contained within the vial of "Putative ataxin-7-like protein 3B (ATXN7L3B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
