Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Plasma membrane calcium-transporting ATPase 1 (ATP2B1) Recombinant Protein | ATP2B1 recombinant protein

Recombinant Human Plasma membrane calcium-transporting ATPase 1 (ATP2B1) , partial

Gene Names
ATP2B1; PMCA1; PMCA1kb
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Plasma membrane calcium-transporting ATPase 1 (ATP2B1); Recombinant Human Plasma membrane calcium-transporting ATPase 1 (ATP2B1); partial; ATP2B1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1061-1220. Partial
Sequence
IPTSRLKFLKEAGHGTQKEEIPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQIRVVNAFRSSLYEGLEKPESRSSIHNFMTHPEFRIEDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEMNKSATSSSPGSPLHSLETSL
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
490
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
130,617 Da
NCBI Official Full Name
plasma membrane calcium-transporting ATPase 1 isoform 1a
NCBI Official Synonym Full Names
ATPase plasma membrane Ca2+ transporting 1
NCBI Official Symbol
ATP2B1
NCBI Official Synonym Symbols
PMCA1; PMCA1kb
NCBI Protein Information
plasma membrane calcium-transporting ATPase 1
UniProt Protein Name
Plasma membrane calcium-transporting ATPase 1
UniProt Gene Name
ATP2B1
UniProt Synonym Gene Names
PMCA1; PMCA1

NCBI Description

The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 1. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.

Research Articles on ATP2B1

Similar Products

Product Notes

The ATP2B1 atp2b1 (Catalog #AAA950532) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1061-1220. Partial. The amino acid sequence is listed below: IPTSRLKFLK EAGHGTQKEE IPEEELAEDV EEIDHAEREL RRGQILWFRG LNRIQTQIRV VNAFRSSLYE GLEKPESRSS IHNFMTHPEF RIEDSEPHIP LIDDTDAEDD APTKRNSSPP PSPNKNNNAV DSGIHLTIEM NKSATSSSPG SPLHSLETSL . It is sometimes possible for the material contained within the vial of "Plasma membrane calcium-transporting ATPase 1 (ATP2B1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.