Cyclic AMP-dependent transcription factor ATF-4 (Atf4) Recombinant Protein | Atf4 recombinant protein

Recombinant Mouse Cyclic AMP-dependent transcription factor ATF-4 (Atf4)

Cat. Num. AAA960245

• Gene Names: Atf4; Atf-4; C/ATF; CREB2; TAXREB67
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cyclic AMP-dependent transcription factor ATF-4 (Atf4); Recombinant Mouse Cyclic AMP-dependent transcription factor ATF-4 (Atf4); Atf4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-349, Full length protein
• Sequence: MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
• Sequence Length: 349

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Atf4 recombinant protein

This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). This protein belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication.

NCBI and Uniprot Product Information

• NCBI GI #: 563317863
• NCBI GeneID: 11911
• NCBI Accession #: NP_001274109.1
• NCBI GenBank Nucleotide #: NM_001287180.1
• UniProt Accession #: Q06507; Q5U4B2; Q61906
• Molecular Weight: 38,355 Da
• NCBI Official Full Name: cyclic AMP-dependent transcription factor ATF-4
• NCBI Official Synonym Full Names: activating transcription factor 4
• NCBI Official Symbol: Atf4
• NCBI Official Synonym Symbols: Atf-4; C/ATF; CREB2; TAXREB67
• NCBI Protein Information: cyclic AMP-dependent transcription factor ATF-4
• UniProt Protein Name: Cyclic AMP-dependent transcription factor ATF-4
• Protein Family: Cyclic AMP-dependent transcription factor
• UniProt Gene Name: Atf4
• UniProt Synonym Gene Names: cAMP-dependent transcription factor ATF-4; C/ATF; TaxREB67 homolog

Uniprot Description

Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Binds to asymmetric CRE's as a heterodimer and to palindromic CRE's as a homodimer. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production. Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to ER stress. In concert with DDIT3/CHOP, activates the transcription of TRIB3 and promotes ER stress-induced neuronal apoptosis by regulating the transcriptional induction of BBC3/PUMA. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes.