GDSL esterase/lipase At5g42170 (At5g42170/At5g42160) Recombinant Protein | At5g42170 recombinant protein
Recombinant Arabidopsis thaliana GDSL esterase/lipase At5g42170 (At5g42170/At5g42160)
Gene Names
AT5G42170; MJC20.28; MJC20_28
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GDSL esterase/lipase At5g42170 (At5g42170/At5g42160); Recombinant Arabidopsis thaliana GDSL esterase/lipase At5g42170 (At5g42170/At5g42160); At5g42170 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
17-369, Full length protein
Sequence
SRNTLERNTETNATEAKVEGKGTIKLPPNVTIPGIITFGDSIVDSGNNNHLRTALKCNFPPYGKDFPGKIATGRFSDGRVPSDIVAERLGIAETIPAYLNPKLKNEDLLKGVNFASGGSGYDPLTAKLVKVVSLSDQLKNFQEYKNKLKVIVGEEKANFLVKNSLYLVVASSNDIAHTYTARSIKYNKTSYADYLADSASKFVSALYGLGARRIGVFSAVPVGCVPAARTLRGKLKRRCSEKLNEVARNFNAKISPTLEALGKELPDSRVVLIDVCDTLNDMIENPKNYGFEVSNRGCCGTGLVEVLFLCNKINPFTCKNSSSYIFWDSYHPTEKAYQIIVDKLLGNYITKLV
Sequence Length
353
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,530 Da
NCBI Official Full Name
SGNH hydrolase-type esterase superfamily protein
NCBI Official Symbol
AT5G42170
NCBI Official Synonym Symbols
MJC20.28; MJC20_28
NCBI Protein Information
SGNH hydrolase-type esterase superfamily protein
UniProt Protein Name
GDSL esterase/lipase At5g42170
UniProt Gene Name
At5g42170/At5g42160
Similar Products
Product Notes
The At5g42170 at5g42170/at5g42160 (Catalog #AAA1442614) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 17-369, Full length protein. The amino acid sequence is listed below: SRNTLERNTE TNATEAKVEG KGTIKLPPNV TIPGIITFGD SIVDSGNNNH LRTALKCNFP PYGKDFPGKI ATGRFSDGRV PSDIVAERLG IAETIPAYLN PKLKNEDLLK GVNFASGGSG YDPLTAKLVK VVSLSDQLKN FQEYKNKLKV IVGEEKANFL VKNSLYLVVA SSNDIAHTYT ARSIKYNKTS YADYLADSAS KFVSALYGLG ARRIGVFSAV PVGCVPAART LRGKLKRRCS EKLNEVARNF NAKISPTLEA LGKELPDSRV VLIDVCDTLN DMIENPKNYG FEVSNRGCCG TGLVEVLFLC NKINPFTCKN SSSYIFWDSY HPTEKAYQII VDKLLGNYIT KLV. It is sometimes possible for the material contained within the vial of "GDSL esterase/lipase At5g42170 (At5g42170/At5g42160), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
