ATP synthase subunit O, mitochondrial (At5g13450) Recombinant Protein | At5g13450 recombinant protein
Recombinant Arabidopsis thaliana ATP synthase subunit O, mitochondrial (At5g13450)
Gene Names
ATP5; delta subunit of Mt ATP synthase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase subunit O; mitochondrial (At5g13450); Recombinant Arabidopsis thaliana ATP synthase subunit O; At5g13450 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
37-238, Full length protein
Sequence
ATASAQTTANVKVPIALVGENGNFASWLYIAAVKMNSLEKIETDLSEMIEAMKTAPIFAQFTKDPSVPRGTRLAAIRDACDQAKFAEPTKNFLSLLAENGKLKNLDAIVKKFMQLTNAHRGDVKVLVTTVIPLPPAEEKELTETLQEIIGAGKKITVEQKIDPSIYGGLIVEFQQKVLDMSIRTRAQQMERLLREPVDFNNL
Sequence Length
202
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,322 Da
NCBI Official Full Name
delta subunit of Mt ATP synthase
NCBI Official Symbol
ATP5
NCBI Official Synonym Symbols
delta subunit of Mt ATP synthase
NCBI Protein Information
delta subunit of Mt ATP synthase
UniProt Protein Name
ATP synthase subunit O, mitochondrial
UniProt Gene Name
At5g13450
UniProt Synonym Gene Names
OSCP
Uniprot Description
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.
Research Articles on At5g13450
Similar Products
Product Notes
The At5g13450 at5g13450 (Catalog #AAA1327823) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 37-238, Full length protein. The amino acid sequence is listed below: ATASAQTTAN VKVPIALVGE NGNFASWLYI AAVKMNSLEK IETDLSEMIE AMKTAPIFAQ FTKDPSVPRG TRLAAIRDAC DQAKFAEPTK NFLSLLAENG KLKNLDAIVK KFMQLTNAHR GDVKVLVTTV IPLPPAEEKE LTETLQEIIG AGKKITVEQK IDPSIYGGLI VEFQQKVLDM SIRTRAQQME RLLREPVDFN NL. It is sometimes possible for the material contained within the vial of "ATP synthase subunit O, mitochondrial (At5g13450), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
