Ankyrin repeat-containing protein At5g02620 Recombinant Protein | ANK1 recombinant protein
Recombinant Arabidopsis thaliana Ankyrin repeat-containing protein At5g02620 (At5g02620)
Gene Names
ANK1; ankyrin-like1; ATANK1; T22P11.210; T22P11_210
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ankyrin repeat-containing protein At5g02620; Recombinant Arabidopsis thaliana Ankyrin repeat-containing protein At5g02620 (At5g02620); ANK1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-524aa; full length protein
Sequence
MKEIKKTMTKQMTARRDDTPLHTAVREGKTDLLLEMIGEHDGVELKELLAEQNQSGETAL YVAAEYGYTDMVKILMKHSDSVLAGTKAKNGFDAFHIAAKNGNLQVLDVLIEANPELSFT FDSSKTTALHTAASQGHGEIVCFLLDKGVDLAAIARSNGKTALHSAARNGHTVIVKKLIE KKAGMVTRVDKKGQTALHMAVKGQNTEIVDVLMEADGSLINSADNKGNTPLHIAVRKNRA EIVQTVLKYCEVSRVAVNKSGETALDIAEKTGLHEIVPLLQKIGMQNARSIKPAEKVEPS GSSRKLKETVSEIGHEVHTQLEQTGRTRREIQGIAKRVNKMHTEGLNNAINSTTLVAILI ATVAFAAIFNVPGQYTDDPKDVPPGYSLGEARAAPRPEFLIFVVFDSFALFISLAVVVVQ TSVVVIERRAKKQMMAIINKLMWMACIMISVAFVSLSFVVVGEKEKPLAVGVTAIGALIM VSTLGTMCYWVIANRIEGSKSSPASMMSDPELADSKHNRKLYAV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ANK1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56,923 Da
NCBI Official Full Name
protein ankyrin-like1
NCBI Official Symbol
ANK1
NCBI Official Synonym Symbols
ankyrin-like1; ATANK1; T22P11.210; T22P11_210
NCBI Protein Information
protein ankyrin-like1
UniProt Protein Name
Ankyrin repeat-containing protein At5g02620
Protein Family
UniProt Gene Name
At5g02620
UniProt Entry Name
Y5262_ARATH
Research Articles on ANK1
Similar Products
Product Notes
The ANK1 at5g02620 (Catalog #AAA7036187) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-524aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ANK1 at5g02620 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKEIKKTMTK QMTARRDDTP LHTAVREGKT DLLLEMIGEH DGVELKELLA EQNQSGETAL YVAAEYGYTD MVKILMKHSD SVLAGTKAKN GFDAFHIAAK NGNLQVLDVL IEANPELSFT FDSSKTTALH TAASQGHGEI VCFLLDKGVD LAAIARSNGK TALHSAARNG HTVIVKKLIE KKAGMVTRVD KKGQTALHMA VKGQNTEIVD VLMEADGSLI NSADNKGNTP LHIAVRKNRA EIVQTVLKYC EVSRVAVNKS GETALDIAEK TGLHEIVPLL QKIGMQNARS IKPAEKVEPS GSSRKLKETV SEIGHEVHTQ LEQTGRTRRE IQGIAKRVNK MHTEGLNNAI NSTTLVAILI ATVAFAAIFN VPGQYTDDPK DVPPGYSLGE ARAAPRPEFL IFVVFDSFAL FISLAVVVVQ TSVVVIERRA KKQMMAIINK LMWMACIMIS VAFVSLSFVV VGEKEKPLAV GVTAIGALIM VSTLGTMCYW VIANRIEGSK SSPASMMSDP ELADSKHNRK LYAV. It is sometimes possible for the material contained within the vial of "Ankyrin repeat-containing protein At5g02620, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
