1-aminocyclopropane-1-carboxylate oxidase homolog 4 (At1g03400) Recombinant Protein | At1g03400 recombinant protein
Recombinant Arabidopsis thaliana 1-aminocyclopropane-1-carboxylate oxidase homolog 4 (At1g03400)
Gene Names
AT1G03400; F21B7.39; F21B7_39
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
1-aminocyclopropane-1-carboxylate oxidase homolog 4 (At1g03400); Recombinant Arabidopsis thaliana 1-aminocyclopropane-1-carboxylate oxidase homolog 4 (At1g03400); At1g03400 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-351, Full length protein
Sequence
MESTDRSSQAKAFDEAKIGVKGLVDSGITEIPALFRATPATLASLKSPPPPKHLTIPTVDLKGASVVEKIGEAAEKWGLFHLVNHGIPVEVLERMIQGIRGFHEQEPEAKKRFYSRDHTRDVLYFSNHDLQNSEAASWRDTLGCYTAPEPPRLEDLPAVCGEIMLEYSKEIMSLGERLFELLSEALGLNSHHLKDMDCAKSQYMVGQHYPPCPQPDLTIGINKHTDISFLTVLLQDNVGGLQVFHEQYWIDVTPVPGALVINIGDFLQLITNDKFISAEHRVIANGSSEPRTSVAIVFSTFMRAYSRVYGPIKDLLSAENPAKYRDCTLTEFSTIFSSKTLDAPKLHHFKI
Sequence Length
351
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,131 Da
NCBI Official Full Name
2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
NCBI Official Symbol
AT1G03400
NCBI Official Synonym Symbols
F21B7.39; F21B7_39
NCBI Protein Information
2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
UniProt Protein Name
1-aminocyclopropane-1-carboxylate oxidase homolog 4
Protein Family
UniProt Gene Name
At1g03400
NCBI Description
A single copy gene that encodes a protein with sequence similarity to tomato E8 (ACC oxidase, the last step in ethylene biosynthesis) involved in ethylene synthesis and fruit ripening in tomato. This gene is not induced by ethylene in siliques. The transcript is found in siliques, etiolated seedlings, leaves, stems and flowers.
Similar Products
Product Notes
The At1g03400 at1g03400 (Catalog #AAA1440454) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-351, Full length protein. The amino acid sequence is listed below: MESTDRSSQA KAFDEAKIGV KGLVDSGITE IPALFRATPA TLASLKSPPP PKHLTIPTVD LKGASVVEKI GEAAEKWGLF HLVNHGIPVE VLERMIQGIR GFHEQEPEAK KRFYSRDHTR DVLYFSNHDL QNSEAASWRD TLGCYTAPEP PRLEDLPAVC GEIMLEYSKE IMSLGERLFE LLSEALGLNS HHLKDMDCAK SQYMVGQHYP PCPQPDLTIG INKHTDISFL TVLLQDNVGG LQVFHEQYWI DVTPVPGALV INIGDFLQLI TNDKFISAEH RVIANGSSEP RTSVAIVFST FMRAYSRVYG PIKDLLSAEN PAKYRDCTLT EFSTIFSSKT LDAPKLHHFK I. It is sometimes possible for the material contained within the vial of "1-aminocyclopropane-1-carboxylate oxidase homolog 4 (At1g03400), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
