Mouse anti-Human RHOH Monoclonal Antibody | anti-RHOH antibody

RHOH (Rho-related GTP-binding Protein RhoH, GTP-binding Protein TTF, Translocation Three Four Protein, ARHH, TTF) (HRP)

Cat. Num. AAA6154634

• Gene Names: RHOH; TTF; ARHH
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RHOH; Monoclonal Antibody; RHOH (Rho-related GTP-binding Protein RhoH; GTP-binding Protein TTF; Translocation Three Four Protein; ARHH; TTF) (HRP); anti-RHOH antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D3
• Specificity: Recognizes human RHOH.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RHOH antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-191 from human RHOH (AAH14261.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVVTQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RHOH is ~1ng/ml as a capture antibody.)

Related Product Information for anti-RHOH antibody

The protein encoded by this gene is a member of the Ras superfamily of small GTPases. Expression of a chimeric transcript of LAZ3 and this gene has been reported as a result of the translocation t(3;4) in non-Hodgkin's lymphomas. This gene encodes a small G-like protein, and unlike most other small G proteins which are expressed ubiquitously, this gene is transcribed only in hemopoietic cells.

Product Categories/Family for anti-RHOH antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 40225704
• NCBI GeneID: 399
• UniProt Accession #: Q15669
• Molecular Weight: 21,331 Da
• NCBI Official Full Name: Homo sapiens ras homolog gene family, member H, mRNA
• NCBI Official Synonym Full Names: ras homolog family member H
• NCBI Official Symbol: RHOH
• NCBI Official Synonym Symbols: TTF; ARHH
• NCBI Protein Information: rho-related GTP-binding protein RhoH
• UniProt Protein Name: Rho-related GTP-binding protein RhoH
• Protein Family: Rho-related GTP-binding protein
• UniProt Gene Name: RHOH
• UniProt Synonym Gene Names: ARHH; TTF
• UniProt Entry Name: RHOH_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Ras superfamily of guanosine triphosphate (GTP)-metabolizing enzymes. The encoded protein is expressed in hematopoietic cells, where it functions as a negative regulator of cell growth and survival. This gene may be hypermutated or misexpressed in leukemias and lymphomas. Chromosomal translocations in non-Hodgkin's lymphoma occur between this locus and B-cell CLL/lymphoma 6 (BCL6) on chromosome 3, leading to the production of fusion transcripts. Alternative splicing in the 5' untranslated region results in multiple transcript variants that encode the same protein. [provided by RefSeq, May 2013]

Uniprot Description

RHOH: Negative regulator of hematopoietic progenitor cell proliferation, survival and migration. Critical regulator of thymocyte development and T-cell antigen receptor (TCR) signaling by mediating recruitment and activation of ZAP70. Required for phosphorylation of CD3Z, membrane translocation of ZAP70 and subsequent activation of the ZAP70-mediated pathways. Essential for efficient beta-selection and positive selection by promoting the ZAP70-dependent phosphorylation of the LAT signalosome during pre-TCR and TCR signaling. Crucial for thymocyte maturation during DN3 to DN4 transition and during positive selection. Plays critical roles in mast cell function by facilitating phosphorylation of SYK in Fc epsilon RI-mediated signal transduction. Essential for the phosphorylation of LAT, LCP2, PLCG1 and PLCG2 and for Ca(2+) mobilization in mast cells. Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins. Inhibits the activation of NF-kappa-B by TNF and IKKB and the activation of CRK/p38 by TNF. Inhibits activities of RAC1, RHOA and CDC42. Negatively regulates leukotriene production in neutrophils. A chromosomal aberration involving RHOH is found in a non-Hodgkin lymphoma cell line. Translocation t(3;4)(q27;p11) with BCL6. Belongs to the small GTPase superfamily. Rho family.

Protein type: G protein; G protein, monomeric, Rho; G protein, monomeric

Chromosomal Location of Human Ortholog: 4p13

Cellular Component: cytoplasm; plasma membrane; immunological synapse; cytosol

Molecular Function: protein binding; Rho GTPase binding; GTP binding; kinase inhibitor activity; GTPase inhibitor activity

Biological Process: regulation of small GTPase mediated signal transduction; regulation of transcription, DNA-dependent; small GTPase mediated signal transduction; negative regulation of catalytic activity; negative regulation of phosphorylation; negative regulation of I-kappaB kinase/NF-kappaB cascade; mast cell activation; T cell differentiation