Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Arsenical Resistance Operon Repressor (arsR) Recombinant Protein | arsR recombinant protein

Recombinant Escherichia Coli Arsenical Resistance Operon Repressor (arsR)

Gene Names
arsR; arsE; ECK3486
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Arsenical Resistance Operon Repressor (arsR); Recombinant Escherichia Coli Arsenical Resistance Operon Repressor (arsR); arsE; arsR recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-117aa; Full Length
Sequence
MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS
Sequence Length
117
Species
Escherichia coli (strain K12)
Tag
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for arsR recombinant protein
Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V)) (By similarity).
References
"An Escherichia coli chromosomal ars operon homolog is functional in arsenic detoxification and is conserved in Gram-negative bacteria." Diorio C., Cai J., Marmor J., Shinder R., Dubow M.S. J. Bacteriol. 177:2050-2056(1995).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.0 kDa
NCBI Official Full Name
DNA-binding transcriptional repressor ArsR
NCBI Official Symbol
arsR
NCBI Official Synonym Symbols
arsE; ECK3486
NCBI Protein Information
DNA-binding transcriptional repressor ArsR
UniProt Protein Name
Arsenical resistance operon repressor
UniProt Gene Name
arsR
UniProt Synonym Gene Names
arsE

NCBI Description

ArsR negatively controls the expression of the genes involved in arsenical and antimonite metals resistance whose expression is induced in the presence of these metals . [More information is available at EcoCyc: EG12235].

Uniprot Description

Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V)) ().

Similar Products

Product Notes

The arsR arsr (Catalog #AAA7115284) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-117aa; Full Length. The amino acid sequence is listed below: MSFLLPIQLF KILADETRLG IVLLLSELGE LCVCDLCTAL DQSQPKISRH LALLRESGLL LDRKQGKWVH YRLSPHIPAW AAKIIDEAWR CEQEKVQAIV RNLARQNCSG DSKNICS. It is sometimes possible for the material contained within the vial of "Arsenical Resistance Operon Repressor (arsR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.