SDS-PAGE
Nickel-responsive regulator Recombinant Protein | nikR recombinant protein
Recombinant Escherichia coli (strain K12) Nickel-responsive regulator
Gene Names
nikR; ECK3465; JW3446; yhhG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nickel-responsive regulator; Recombinant Escherichia coli (strain K12) Nickel-responsive regulator; nikR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-133, Full length protein
Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED
Sequence Length
133
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for nikR recombinant protein
Transcriptional repressor of the nikABCDE operon. Is active in the presence of excessive concentrations of intracellular nickel.
References
Isolation and characterization of the nikR gene encoding a nickel-responsive regulator in Escherichia coli.De Pina K., Desjardin V., Mandrand-Berthelot M.-A., Giordano G., Wu L.-F.J. Bacteriol. 181:670-674(1999)
Rhs elements of Escherichia coli K-12 complex composites of shared and unique components that have different evolutionary histories.Zhao S., Sandt C.H., Feulner G., Vlazny D.A., Gray J.A., Hill C.W.J. Bacteriol. 175:2799-2808(1993)
Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes.Sofia H.J., Burland V., Daniels D.L., Plunkett G. III, Blattner F.R.Nucleic Acids Res. 22:2576-2586(1994)
The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Analysis of products of the Escherichia coli genomic genes and regulation of their expressions
an applicable procedure for genomic analysis of other microorganisms.Talukder A.A., Yanai S., Yamada M.Biosci. Biotechnol. Biochem. 58:117-120(1994)
NikR is a ribbon-helix-helix DNA-binding protein.Chivers P.T., Sauer R.T.Protein Sci. 8:2494-2500(1999)
Regulation of high affinity nickel uptake in bacteria. Ni2+-dependent interaction of NikR with wild-type and mutant operator sites.Chivers P.T., Sauer R.T.J. Biol. Chem. 275:19735-19741(2000)
Crystal structure of the nickel-responsive transcription factor NikR.Schreiter E.R., Sintchak M.D., Guo Y., Chivers P.T., Sauer R.T., Drennan C.L.Nat. Struct. Biol. 10:794-799(2003)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19.2kD
NCBI Official Full Name
transcriptional repressor, Ni-binding
NCBI Official Symbol
nikR
NCBI Official Synonym Symbols
ECK3465; JW3446; yhhG
NCBI Protein Information
transcriptional repressor, Ni-binding
UniProt Protein Name
Nickel-responsive regulator
Protein Family
UniProt Gene Name
nikR
UniProt Synonym Gene Names
yhhG
UniProt Entry Name
NIKR_ECOLI
NCBI Description
ACT-like domain (Grant, 2006). [More information is available at EcoGene: EG11519].
Uniprot Description
Transcriptional repressor of the nikABCDE operon. Is active in the presence of excessive concentrations of intracellular nickel.
Research Articles on nikR
Similar Products
Product Notes
The nikR nikr (Catalog #AAA1081205) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-133, Full length protein. The amino acid sequence is listed below: MQRVTITLDD DLLETLDSLS QRRGYNNRSE AIRDILRSAL AQEATQQHGT QGFAVLSYVY EHEKRDLASR IVSTQHHHHD LSVATLHVHI NHDDCLEIAV LKGDMGDVQH FADDVIAQRG VRHGHLQCLP KED. It is sometimes possible for the material contained within the vial of "Nickel-responsive regulator, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
