Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PRA1 family protein 3 (ARL6IP5) Recombinant Protein | ARL6IP5 recombinant protein

Recombinant Human PRA1 family protein 3 (ARL6IP5)

Gene Names
ARL6IP5; JWA; jmx; hp22; PRAF3; DERP11; HSPC127; addicsin; GTRAP3-18
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
PRA1 family protein 3 (ARL6IP5); Recombinant Human PRA1 family protein 3 (ARL6IP5); Recombinant PRA1 family protein 3 (ARL6IP5); PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5 Cytoskeleton-related vitamin A-responsive protein Dermal papilla-derived protein 11 GTRAP3; ARL6IP5 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-188
Sequence
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Sequence Length
188
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,615 Da
NCBI Official Full Name
PRA1 family protein 3
NCBI Official Synonym Full Names
ADP-ribosylation-like factor 6 interacting protein 5
NCBI Official Symbol
ARL6IP5
NCBI Official Synonym Symbols
JWA; jmx; hp22; PRAF3; DERP11; HSPC127; addicsin; GTRAP3-18
NCBI Protein Information
PRA1 family protein 3; JM5; aip-5; protein JWa; PRA1 domain family 3; ARL-6-interacting protein 5; dermal papilla derived protein 11; dermal papilla-derived protein 11; prenylated Rab acceptor protein 2; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; glutamate transporter EEAC1-associated protein; glutamate transporter EAAC1-interacting protein; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; ADP-ribosylation factor-like protein 6-interacting protein 5
UniProt Protein Name
PRA1 family protein 3
Protein Family
UniProt Gene Name
ARL6IP5
UniProt Synonym Gene Names
DERP11; JWA; PRA2; PRAF3; ARL-6-interacting protein 5; Aip-5
UniProt Entry Name
PRAF3_HUMAN

NCBI Description

Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq, Jul 2008]

Uniprot Description

ARL6IP5: Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate. May be involved in membrane traffic. Belongs to the PRA1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Cytoskeletal; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 3p14

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein C-terminus binding

Biological Process: L-glutamate transport; positive regulation of apoptosis; positive regulation of caspase activity; negative regulation of transport; induction of apoptosis by oxidative stress; positive regulation of stress-activated MAPK cascade

Research Articles on ARL6IP5

Similar Products

Product Notes

The ARL6IP5 arl6ip5 (Catalog #AAA1059820) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-188. The amino acid sequence is listed below: MDVNIAPLRA WDDFFPGSDR FARPDFRDIS KWNNRVVSNL LYYQTNYLVV AAMMISIVGF LSPFNMILGG IVVVLVFTGF VWAAHNKDVL RRMKKRYPTT FVMVVMLASY FLISMFGGVM VFVFGITFPL LLMFIHASLR LRNLKNKLEN KMEGIGLKRT PMGIVLDALE QQEEGINRLT DYISKVKE. It is sometimes possible for the material contained within the vial of "PRA1 family protein 3 (ARL6IP5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.