Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

ADP-ribosylation factor 5 Recombinant Protein | ARF5 recombinant protein

Recombinant Human ADP-ribosylation factor 5 protein

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ADP-ribosylation factor 5; Recombinant Human ADP-ribosylation factor 5 protein; ARF5 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-180aa; Full Length
Sequence
GLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Sequence Length
180
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ARF5 recombinant protein
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Product Categories/Family for ARF5 recombinant protein
References
Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells.Tsuchiya M., Price S.R., Tsai S.-C., Moss J., Vaughan M.J. Biol. Chem. 266:2772-2777(1991)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
381
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.4 kDa
NCBI Official Full Name
ADP-ribosylation factor 5
NCBI Official Synonym Full Names
ADP ribosylation factor 5
NCBI Official Symbol
ARF5
NCBI Protein Information
ADP-ribosylation factor 5
UniProt Protein Name
ADP-ribosylation factor 5
Protein Family
UniProt Gene Name
ARF5
UniProt Entry Name
ARF5_HUMAN

NCBI Description

This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010]

Uniprot Description

ARF5: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Belongs to the small GTPase superfamily. Arf family.

Protein type: Motility/polarity/chemotaxis; G protein, monomeric; G protein, monomeric, ARF; G protein

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; plasma membrane

Molecular Function: GTP binding; GTPase activity; protein binding

Biological Process: protein transport; small GTPase mediated signal transduction; vesicle-mediated transport

Research Articles on ARF5

Similar Products

Product Notes

The ARF5 arf5 (Catalog #AAA717228) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-180aa; Full Length. The amino acid sequence is listed below: GLTVSALFSR IFGKKQMRIL MVGLDAAGKT TILYKLKLGE IVTTIPTIGF NVETVEYKNI CFTVWDVGGQ DKIRPLWRHY FQNTQGLIFV VDSNDRERVQ ESADELQKML QEDELRDAVL LVFANKQDMP NAMPVSELTD KLGLQHLRSR TWYVQATCAT QGTGLYDGLD WLSHELSKR. It is sometimes possible for the material contained within the vial of "ADP-ribosylation factor 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual