ADP-ribosylation factor 5 Recombinant Protein | ARF5 recombinant protein

Recombinant Human ADP-ribosylation factor 5 protein

Cat. Num. AAA717228

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ADP-ribosylation factor 5; Recombinant Human ADP-ribosylation factor 5 protein; ARF5 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-180aa; Full Length
• Sequence: GLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
• Sequence Length: 180

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ARF5 recombinant protein

GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Product Categories/Family for ARF5 recombinant protein

Transport

References

Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells.Tsuchiya M., Price S.R., Tsai S.-C., Moss J., Vaughan M.J. Biol. Chem. 266:2772-2777(1991)

NCBI and Uniprot Product Information

• NCBI GI #: 4502209
• NCBI GeneID: 381
• NCBI Accession #: NP_001653.1
• NCBI GenBank Nucleotide #: NM_001662.3
• UniProt Accession #: P84085; P26437
• Molecular Weight: 47.4 kDa
• NCBI Official Full Name: ADP-ribosylation factor 5
• NCBI Official Synonym Full Names: ADP ribosylation factor 5
• NCBI Official Symbol: ARF5
• NCBI Protein Information: ADP-ribosylation factor 5
• UniProt Protein Name: ADP-ribosylation factor 5
• Protein Family: Auxin response factor
• UniProt Gene Name: ARF5
• UniProt Entry Name: ARF5_HUMAN

NCBI Description

This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010]

Uniprot Description

ARF5: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Belongs to the small GTPase superfamily. Arf family.

Protein type: Motility/polarity/chemotaxis; G protein, monomeric; G protein, monomeric, ARF; G protein

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; plasma membrane

Molecular Function: GTP binding; GTPase activity; protein binding

Biological Process: protein transport; small GTPase mediated signal transduction; vesicle-mediated transport