Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

ADP-ribosylation factor 3 (ARF3) Recombinant Protein | ARF3 recombinant protein

Recombinant Human ADP-ribosylation factor 3 (ARF3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ADP-ribosylation factor 3 (ARF3); Recombinant Human ADP-ribosylation factor 3 (ARF3); ADP-ribosylation factor 3; ARF3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-181aa; Full Length
Sequence
GNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
Sequence Length
180
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for ARF3 recombinant protein
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Product Categories/Family for ARF3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
377
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.5 kDa
NCBI Official Full Name
ADP-ribosylation factor 3
NCBI Official Synonym Full Names
ADP-ribosylation factor 3
NCBI Official Symbol
ARF3
NCBI Protein Information
ADP-ribosylation factor 3; small GTP binding protein
UniProt Protein Name
ADP-ribosylation factor 3
Protein Family
UniProt Gene Name
ARF3
UniProt Entry Name
ARF3_HUMAN

NCBI Description

ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns. [provided by RefSeq, Jul 2008]

Uniprot Description

ARF3: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Belongs to the small GTPase superfamily. Arf family.

Protein type: Motility/polarity/chemotaxis; G protein, monomeric, ARF; G protein, monomeric; G protein

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: Golgi membrane; perinuclear region of cytoplasm

Molecular Function: GTPase activity; GTP binding

Biological Process: vesicle-mediated transport; protein transport; phospholipid metabolic process; small GTPase mediated signal transduction; phosphatidylinositol biosynthetic process

Research Articles on ARF3

Similar Products

Product Notes

The ARF3 arf3 (Catalog #AAA957171) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-181aa; Full Length. The amino acid sequence is listed below: GNIFGNLLKS LIGKKEMRIL MVGLDAAGKT TILYKLKLGE IVTTIPTIGF NVETVEYKNI SFTVWDVGGQ DKIRPLWRHY FQNTQGLIFV VDSNDRERVN EAREELMRML AEDELRDAVL LVFANKQDLP NAMNAAEITD KLGLHSLRHR NWYIQATCAT SGDGLYEGLD WLANQLKNKK. It is sometimes possible for the material contained within the vial of "ADP-ribosylation factor 3 (ARF3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.