Annexin A4 (ANXA4) Recombinant Protein | ANXA4 recombinant protein

Recombinant Human Annexin A4 (ANXA4)

Cat. Num. AAA968563

• Gene Names: ANXA4; ANX4; PIG28; ZAP36; HEL-S-274
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Annexin A4 (ANXA4); Recombinant Human Annexin A4 (ANXA4); Annexin A4; 35-beta calcimedin; Annexin IV; Annexin-4; Carbohydrate-binding protein p33/p41; Chromobindin-4; Endonexin I; Lipocortin IV; P32.5; PP4-X; Placental anticoagulant protein II; PAP-II; Protein II; ANXA4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-319aa; Full Length of Mature Protein
• Sequence: ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
• Sequence Length: 318

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for ANXA4 recombinant protein

Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

Product Categories/Family for ANXA4 recombinant protein

Cardiovascular

NCBI and Uniprot Product Information

• NCBI GI #: 4502105
• NCBI GeneID: 307
• NCBI Accession #: NP_001144.1
• NCBI GenBank Nucleotide #: NM_001153.3
• UniProt Accession #: P09525; Q96F33; Q9BWK1; B4DDF9
• Molecular Weight: 55.8 kDa
• NCBI Official Full Name: annexin A4
• NCBI Official Synonym Full Names: annexin A4
• NCBI Official Symbol: ANXA4
• NCBI Official Synonym Symbols: ANX4; PIG28; ZAP36; HEL-S-274
• NCBI Protein Information: annexin A4; P32.5; PP4-X; PAP-II; annexin-4; protein II; endonexin I; lipocortin IV; chromobindin-4; 35-beta calcimedin; proliferation-inducing gene 28; proliferation-inducing protein 28; placental anticoagulant protein II; epididymis secretory protein Li 274; carbohydrate-binding protein p33/p41; annexin IV (placental anticoagulant protein II)
• UniProt Protein Name: Annexin A4
• Protein Family: Annexin
• UniProt Gene Name: ANXA4
• UniProt Synonym Gene Names: ANX4; PAP-II
• UniProt Entry Name: ANXA4_HUMAN

NCBI Description

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq, Jul 2008]

Uniprot Description

ANXA4: a calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.

Protein type: Calcium-binding; Lipid-binding

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: nuclear membrane; cell surface; perinuclear region of cytoplasm; cytoplasm; plasma membrane; vesicle membrane; nucleus

Molecular Function: phospholipase inhibitor activity; NF-kappaB binding; identical protein binding; calcium-dependent phospholipid binding; calcium ion binding; calcium-dependent protein binding

Biological Process: regulation of transcription from RNA polymerase II promoter; epithelial cell differentiation; inhibition of NF-kappaB transcription factor; negative regulation of catalytic activity; signal transduction; negative regulation of apoptosis