Probable starch degradation products transport system permease protein AmyD (amyD) Recombinant Protein | amyD recombinant protein
Recombinant Thermoanaerobacter thermosulfurogenes Probable starch degradation products transport system permease protein AmyD (amyD)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable starch degradation products transport system permease protein AmyD (amyD); Recombinant Thermoanaerobacter thermosulfurogenes Probable starch degradation products transport system permease protein AmyD (amyD); Recombinant Probable starch degradation products transport system permease protein AmyD (amyD); Probable starch degradation products transport system permease protein AmyD; amyD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-292
Sequence
MAKKAKFFKNGIWYWLFIAPTLLSLIIVVLIPFIIGIYYSFTDWNGINQPVFIGLKNFMTLRDDAEFWNSIIFTAKFAVACIVIINVVGLSLAMLVTRKIFARNFMRTAFYLPNLIGGLILGFIWNFIFVDVFQTISDATHIGWLGGWLSTTNTGFWGLVIVTSWQMIGYVMVIYIAYIESIPTDLIEASKIDGANSWQQFRNVVFPLIAPAFTVSLFITLSNSFKLFDQNLSLTAGAPGNTTQMITLNIYQTAFSAQEMAVGQAKAVIMFLIIAVISVIQVYLTQKREVEM
Sequence Length
292
Species
Thermoanaerobacter thermosulfurogenes (Clostridium thermosulfurogenes)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
32,908 Da
NCBI Official Full Name
Probable starch degradation products transport system permease protein AmyD
UniProt Protein Name
Probable starch degradation products transport system permease protein AmyD
Protein Family
UniProt Gene Name
amyD
UniProt Entry Name
AMYD_THETU
Uniprot Description
Function: Probably part of a binding-protein-dependent transport system starch degradation products. Probably responsible for the translocation of the substrate across the membrane.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. MalFG subfamily.Contains 1 ABC transmembrane type-1 domain.
Similar Products
Product Notes
The Probable starch degradation products transport system permease protein AmyD (amyD) amyd (Catalog #AAA1095908) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-292. The amino acid sequence is listed below: MAKKAKFFKN GIWYWLFIAP TLLSLIIVVL IPFIIGIYYS FTDWNGINQP VFIGLKNFMT LRDDAEFWNS IIFTAKFAVA CIVIINVVGL SLAMLVTRKI FARNFMRTAF YLPNLIGGLI LGFIWNFIFV DVFQTISDAT HIGWLGGWLS TTNTGFWGLV IVTSWQMIGY VMVIYIAYIE SIPTDLIEAS KIDGANSWQQ FRNVVFPLIA PAFTVSLFIT LSNSFKLFDQ NLSLTAGAPG NTTQMITLNI YQTAFSAQEM AVGQAKAVIM FLIIAVISVI QVYLTQKREV EM. It is sometimes possible for the material contained within the vial of "Probable starch degradation products transport system permease protein AmyD (amyD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
