Aryl-hydrocarbon-interacting protein-like 1 (AIPL1) Recombinant Protein | AIPL1 recombinant protein
Recombinant Bovine Aryl-hydrocarbon-interacting protein-like 1 (AIPL1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aryl-hydrocarbon-interacting protein-like 1 (AIPL1); Recombinant Bovine Aryl-hydrocarbon-interacting protein-like 1 (AIPL1); AIPL1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-328, full length protein
Sequence
MDATLLLNVEGIKKTILHGGTGDLPNFITGARVTFHFRTMKCDEERTVIDDSKQVGHPMHIIIGNMFKLEVWEILLTSMRVSEVAEFWCDTIHTGVYPILSRSLRQMAEGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLIFIIELLQVEAPSQYQRETWNLNNQEKMQAVPILHGEGNRLFKLGRYEEASNKYQEAIVCLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLEKVLELEPSMRKAVQRELRLLENRLEEKREEERLRCRNMLG
Sequence Length
328
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for AIPL1 recombinant protein
Leber congenital amaurosis (LCA) accounts for at least 5% of all inherited retinal disease and is the most severe inherited retinopathy with the earliest age of onset. Individuals affected with LCA are identified at birth or in the first few months of life with severely impaired vision or blindness, nystagmus and an abnormal or flat electroretinogram. The photoreceptor
pineal -expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, was mapped within the LCA4 candidate region. The protein contains three tetratricopeptide motifs, consistent with nuclear transport or chaperone activity. AIPL1 mutations may cause approximately 20% of recessive LCA.
pineal -expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, was mapped within the LCA4 candidate region. The protein contains three tetratricopeptide motifs, consistent with nuclear transport or chaperone activity. AIPL1 mutations may cause approximately 20% of recessive LCA.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,472 Da
NCBI Official Full Name
aryl-hydrocarbon-interacting protein-like 1
NCBI Official Synonym Full Names
aryl hydrocarbon receptor interacting protein like 1
NCBI Official Symbol
AIPL1
NCBI Protein Information
aryl-hydrocarbon-interacting protein-like 1
UniProt Protein Name
Aryl-hydrocarbon-interacting protein-like 1
Protein Family
UniProt Gene Name
AIPL1
Uniprot Description
May be important in protein trafficking and/or protein folding and stabilization.
Similar Products
Product Notes
The AIPL1 aipl1 (Catalog #AAA1304519) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-328, full length protein. The amino acid sequence is listed below: MDATLLLNVE GIKKTILHGG TGDLPNFITG ARVTFHFRTM KCDEERTVID DSKQVGHPMH IIIGNMFKLE VWEILLTSMR VSEVAEFWCD TIHTGVYPIL SRSLRQMAEG KDPTEWHVHT CGLANMFAYH TLGYEDLDEL QKEPQPLIFI IELLQVEAPS QYQRETWNLN NQEKMQAVPI LHGEGNRLFK LGRYEEASNK YQEAIVCLRN LQTKEKPWEV QWLKLEKMIN TLILNYCQCL LKKEEYYEVL EHTSDILRHH PGIVKAYYVR ARAHAEVWNE AEAKADLEKV LELEPSMRKA VQRELRLLEN RLEEKREEER LRCRNMLG. It is sometimes possible for the material contained within the vial of "Aryl-hydrocarbon-interacting protein-like 1 (AIPL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
