Mouse AIPL1 Monoclonal Antibody | anti-AIPL1 antibody

AIPL1 (Aryl Hydrocarbon Receptor Interacting Protein-like 1, AIPL2, LCA4) (AP)

Cat. Num. AAA6164808

• Gene Names: AIPL1; LCA4; AIPL2
• Applications: Immunoprecipitation
• Purity: Purified
• Synonyms: AIPL1; Monoclonal Antibody; AIPL1 (Aryl Hydrocarbon Receptor Interacting Protein-like 1; AIPL2; LCA4) (AP); Aryl Hydrocarbon Receptor Interacting Protein-like 1; LCA4; anti-AIPL1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3A3
• Specificity: Recognizes AIPL1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-AIPL1 antibody: Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: AIPL1 (NP_055151.3, 1aa-101aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged AIPL1 is 0.3 ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of AIPL1 transfected lysate using anti-AIPL1 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with AIPL1 MaxPab rabbit polyclonal antibody.)

Related Product Information for anti-AIPL1 antibody

Leber congenital amaurosis (LCA) accounts for at least 5% of all inherited retinal disease and is the most severe inherited retinopathy with the earliest age of onset. Individuals affected with LCA are identify at birth or in the first few months of life with severely impaired vision or blindness, nystagmus and an abnormal or flat electroretinogram. The photoreceptor/pineal -expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, was mapped within the LCA4 candidate region. The protein contains three tetratricopeptide motifs, consistent with nuclear transport or chaperone activity. AIPL1 mutations may cause approximately 20% of recessive LCA. [provided by RefSeq]

Product Categories/Family for anti-AIPL1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 74272276
• NCBI GeneID: 23746
• NCBI Accession #: NP_055151.3
• NCBI GenBank Nucleotide #: NM_014336.4
• UniProt Accession #: Q9NZN9; Q659W3; Q659W4; Q6ZZB6; Q8N6A0; Q9H873; Q9NS10; D3DTM4
• Molecular Weight: 40,901 Da
• NCBI Official Full Name: aryl-hydrocarbon-interacting protein-like 1 isoform 1
• NCBI Official Synonym Full Names: aryl hydrocarbon receptor interacting protein-like 1
• NCBI Official Symbol: AIPL1
• NCBI Official Synonym Symbols: LCA4; AIPL2
• NCBI Protein Information: aryl-hydrocarbon-interacting protein-like 1
• UniProt Protein Name: Aryl-hydrocarbon-interacting protein-like 1
• Protein Family: Aryl-hydrocarbon-interacting protein
• UniProt Gene Name: AIPL1
• UniProt Synonym Gene Names: AIPL2
• UniProt Entry Name: AIPL1_HUMAN

NCBI Description

Leber congenital amaurosis (LCA) is the most severe inherited retinopathy with the earliest age of onset and accounts for at least 5% of all inherited retinal diseases. Affected individuals are diagnosed at birth or in the first few months of life with nystagmus, severely impaired vision or blindness and an abnormal or flat electroretinogram. The photoreceptor/pineal-expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, is located within the LCA4 candidate region. The encoded protein contains three tetratricopeptide motifs, consistent with chaperone or nuclear transport activity. Mutations in this gene may cause approximately 20% of recessive LCA. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

AIPL1: May be important in protein trafficking and/or protein folding and stabilization. Defects in AIPL1 are the cause of Leber congenital amaurosis type 4 (LCA4). LCA designates a clinically and genetically heterogeneous group of childhood retinal degenerations, generally inherited in an autosomal recessive manner. Affected infants have little or no retinal photoreceptor function as tested by electroretinography. LCA represents the most common genetic cause of congenital visual impairment in infants and children. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Chaperone; Apoptosis

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: photoreceptor inner segment; cytoplasm; nucleus

Molecular Function: farnesylated protein binding; protein binding; unfolded protein binding

Biological Process: phototransduction, visible light; retinal homeostasis; protein farnesylation; protein folding; visual perception; regulation of cGMP metabolic process; negative regulation of apoptosis

Disease: Leber Congenital Amaurosis 4; Retinitis Pigmentosa