Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Alpha-2-HS-Glycoprotein Recombinant Protein | AHSG HEK recombinant protein

Recombinant Human Alpha-2-HS-Glycoprotein HEK

Gene Names
AHSG; AHS; A2HS; HSGA; FETUA
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Alpha-2-HS-Glycoprotein; Recombinant Human Alpha-2-HS-Glycoprotein HEK; AHSG Human HEK; Alpha-2-HS-Glycoprotein Human Recombinant HEK; Alpha-2-HS-glycoprotein; Fetuin-A; Alpha-2-Z-globulin; Ba-alpha-2-glycoprotein; AHSG; FETUA; AHS; A2HS; HSGA; PRO2743; AHSG HEK recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
AHSG was lyophilized from a 0.2 uM filtered solution of 20mM PB and 150mM NaCl, pH 7.5.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVVDHHHHHH.
Sequence Length
367
Solubility
It is recommended to reconstitute the lyophilized AHSG in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Related Product Information for AHSG HEK recombinant protein
Description: AHSG Human Recombinant produced by transfected human cells is a single polypeptide chain containing 357 amino acids (19-367). AHSG is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Introduction: Fetuin is a liver-produced negative acute phase protein composed of two subunits, the A and B chains.Fetuin homologs have been identified in several species including rat, sheep, pig, rabbit, guinea pig, cattle, mouse and human. Multiple physiological roles for these homologs have been suggested, including ability to bind to hydroxyapatite crystals and to specifically inhibit the tyrosine kinase (TK) activity of the insulin receptor (IR).Fetuin-A (alpha2-Heremans-Schmid glycoprotein; AHSG) is an important circulating inhibitor of calcification in vivo, and is downregulated during the acute-phase response.Sera from patients on long-term dialysis with low AHSG concentrations showed impaired ex-vivo capacity to inhibit CaxPO4 precipitation.Fetuin may influence the resolution of inflammation by modulating the phagocytosis of apoptotic cells by macrophages.ASHG blocks TGF-beta-dependent signaling in osteoblastic cells, and mice lacking ASHG display growth plate defects, increased bone formation with age, and enhanced cytokine-dependent osteogenesis.
Product Categories/Family for AHSG HEK recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
197
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,325 Da
NCBI Official Full Name
alpha-2-HS-glycoprotein preproprotein
NCBI Official Synonym Full Names
alpha-2-HS-glycoprotein
NCBI Official Symbol
AHSG
NCBI Official Synonym Symbols
AHS; A2HS; HSGA; FETUA
NCBI Protein Information
alpha-2-HS-glycoprotein; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; fetuin-A
UniProt Protein Name
Alpha-2-HS-glycoprotein
Protein Family
UniProt Gene Name
AHSG
UniProt Synonym Gene Names
FETUA
UniProt Entry Name
FETUA_HUMAN

NCBI Description

Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. [provided by RefSeq, Jul 2008]

Uniprot Description

FETUA: Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions. Alpha-2-HS glycoprotein derives from this precursor, when the connecting peptide is cleaved off. The two chains A and B are held together by a single disulfide bond. Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins. Belongs to the fetuin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: extracellular space; extracellular region

Molecular Function: kinase inhibitor activity; cysteine protease inhibitor activity

Biological Process: pinocytosis; negative regulation of bone mineralization; ossification; positive regulation of phagocytosis; regulation of inflammatory response; acute-phase response; negative regulation of insulin receptor signaling pathway; negative regulation of phosphorylation; skeletal development; regulation of bone mineralization

Research Articles on AHSG HEK

Similar Products

Product Notes

The AHSG HEK ahsg (Catalog #AAA146209) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: APHGPGLIYR QPNCDDPETE EAALVAIDYI NQNLPWGYKH TLNQIDEVKV WPQQPSGELF EIEIDTLETT CHVLDPTPVA RCSVRQLKEH AVEGDCDFQL LKLDGKFSVV YAKCDSSPDS AEDVRKVCQD CPLLAPLNDT RVVHAAKAAL AAFNAQNNGS NFQLEEISRA QLVPLPPSTY VEFTVSGTDC VAKEATEAAK CNLLAEKQYG FCKATLSEKL GGAEVAVTCT VFQTQPVTSQ PQPEGANEAV PTPVVDPDAP PSPPLGAPGL PPAGSPPDSH VLLAAPPGHQ LHRAHYDLRH TFMGVVSLGS PSGEVSHPRK TRTVVQPSVG AAAGPVVPPC PGRIRHFKVV DHHHHHH.. It is sometimes possible for the material contained within the vial of "Alpha-2-HS-Glycoprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.