Poly (ADP-ribose) glycohydrolase ARH3 (adprhl2) Recombinant Protein | adprhl2 recombinant protein

Recombinant Danio rerio Poly (ADP-ribose) glycohydrolase ARH3 (adprhl2)

Cat. Num. AAA1282245

• Gene Names: adprhl2; fj36e06; zgc:92867; wu:fj36e06
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Poly (ADP-ribose) glycohydrolase ARH3 (adprhl2); Recombinant Danio rerio Poly (ADP-ribose) glycohydrolase ARH3 (adprhl2); adprhl2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-370, Full length protein
• Sequence: MSAAARVVAPVMMLSRFRGALVGSVLGDCIGGEFEGAVDVPLDRVLQHLSALEDDTRGDGILQYSDDTAMMRCVADSLLTRMTFDERDMAQRFAKEYSHSPGRGYGSGVVQVLRKLASPHLKDVFQPAQAQFGGRGSFGNGGAMRAVPFALAFRSRADVRKYSRFGAMLTHSCSLGYNGAALQALAVHLSLQGALALPKDFIDKLISEMEELEKDETAKHDAKALNLSEFPYCSRLHRVKELMDKTSVSIEEVISELGNGIAALQSVPTAIFCVLYCLEPQDGLPERFGGLERTIAYSLALGGDTDTIACMAGAIAGAHYGIDSIPLSWQVSCEGVDEADDLARRLYDLYCLPQHNEDRGNNQPHTTNTD
• Sequence Length: 370

• Species: Zebrafish
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 319738620
• NCBI GeneID: 796446
• NCBI Accession #: NP_001004565.2
• NCBI GenBank Nucleotide #: NM_001004565.2
• UniProt Accession #: Q66HT8; A7MCF6
• Molecular Weight: 40,103 Da
• NCBI Official Full Name: poly(ADP-ribose) glycohydrolase ARH3
• NCBI Official Synonym Full Names: ADP-ribosylhydrolase like 2
• NCBI Official Symbol: adprhl2
• NCBI Official Synonym Symbols: fj36e06; zgc:92867; wu:fj36e06
• NCBI Protein Information: poly(ADP-ribose) glycohydrolase ARH3
• UniProt Protein Name: Poly(ADP-ribose) glycohydrolase ARH3
• Protein Family: Poly(ADP-ribose) glycohydrolase
• UniProt Gene Name: adprhl2
• UniProt Synonym Gene Names: arh3

Uniprot Description

Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase. Poly(ADP-ribose) metabolism may be required for maintenance of the normal function of neuronal cells. Generates ADP-ribose from poly-(ADP-ribose), but does not hydrolyze ADP-ribose-arginine, -cysteine, -diphthamide, or -asparagine bonds ().