Probable G-protein coupled receptor 97 (GPR97) Recombinant Protein | GPR97 recombinant protein
Recombinant Human Probable G-protein coupled receptor 97 (GPR97)
Gene Names
ADGRG3; PB99; GPR97; PGR26
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable G-protein coupled receptor 97 (GPR97); Recombinant Human Probable G-protein coupled receptor 97 (GPR97); GPR97 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-549aa; full length protein
Sequence
QEKPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSDSCNVENLQRYWLNYEAHLMK EGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQVMKDEDKPPDRVRLPKSLFRS LPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVLNNRLVGLSVGQMHVTKLAEPLEI VFSHQRPPPNMTLTCVFWDVTKGTTGDWSSEGCSTEVRPEGTVCCCDHLTFFALLLRPTL DQSTVHILTRISQAGCGVSMIFLAFTIILYAFLRLSRERFKSEDAPKIHVALGGSLFLLN LAFLVNVGSGSKGSDAACWARGAVFHYFLLCAFTWMGLEAFHLYLLAVRVFNTYFGHYFL KLSLVGWGLPALMVIGTGSANSYGLYTIRDRENRTSLELCWFREGTTMYALYITVHGYFL ITFLFGMVVLALVVWKIFTLSRATAVKERGKNRKKVLTLLGLSSLVGVTWGLAIFTPLGL STVYIFALFNSLQGVFICCWFTILYLPSQSTTVSSSTARLDQAHSASQE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GPR97 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,861 Da
NCBI Official Full Name
adhesion G protein-coupled receptor G3 isoform 2
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor G3
NCBI Official Symbol
ADGRG3
NCBI Official Synonym Symbols
PB99; GPR97; PGR26
NCBI Protein Information
adhesion G protein-coupled receptor G3
UniProt Protein Name
Adhesion G protein-coupled receptor G3
UniProt Gene Name
ADGRG3
UniProt Entry Name
AGRG3_HUMAN
Uniprot Description
GPR97: Orphan receptor. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 2
Chromosomal Location of Human Ortholog: 16q21
Cellular Component: integral to membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity
Biological Process: B cell differentiation; cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway; inhibition of CREB transcription factor; regulation of cell migration
Research Articles on GPR97
Similar Products
Product Notes
The GPR97 adgrg3 (Catalog #AAA7016272) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-549aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GPR97 adgrg3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QEKPTEGPRN TCLGSNNMYD IFNLNDKALC FTKCRQSGSD SCNVENLQRY WLNYEAHLMK EGLTQKVNTP FLKALVQNLS TNTAEDFYFS LEPSQVPRQV MKDEDKPPDR VRLPKSLFRS LPGNRSVVRL AVTILDIGPG TLFKGPRLGL GDGSGVLNNR LVGLSVGQMH VTKLAEPLEI VFSHQRPPPN MTLTCVFWDV TKGTTGDWSS EGCSTEVRPE GTVCCCDHLT FFALLLRPTL DQSTVHILTR ISQAGCGVSM IFLAFTIILY AFLRLSRERF KSEDAPKIHV ALGGSLFLLN LAFLVNVGSG SKGSDAACWA RGAVFHYFLL CAFTWMGLEA FHLYLLAVRV FNTYFGHYFL KLSLVGWGLP ALMVIGTGSA NSYGLYTIRD RENRTSLELC WFREGTTMYA LYITVHGYFL ITFLFGMVVL ALVVWKIFTL SRATAVKERG KNRKKVLTLL GLSSLVGVTW GLAIFTPLGL STVYIFALFN SLQGVFICCW FTILYLPSQS TTVSSSTARL DQAHSASQE. It is sometimes possible for the material contained within the vial of "Probable G-protein coupled receptor 97 (GPR97), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
