EGF-like module-containing mucin-like hormone receptor-like 3 (EMR3) Recombinant Protein | EMR3 recombinant protein

Recombinant Human EGF-like module-containing mucin-like hormone receptor-like 3 (EMR3)

Cat. Num. AAA7014258

• Gene Names: ADGRE3; EMR3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: EGF-like module-containing mucin-like hormone receptor-like 3 (EMR3); Recombinant Human EGF-like module-containing mucin-like hormone receptor-like 3 (EMR3); EMR3 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 339-652aa; full length protein
• Sequence: SSFAVLMALTSQEEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLC LFLAHLLFLVGIDRTEPKVLCSIIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSS INRLMKWIMFPVGYGVPAVTVAISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSA NLVLFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQV MAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKP SEGDVFPGQVKRKY
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for EMR3 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 574584843
• NCBI GeneID: 84658
• NCBI Accession #: NP_001276087.1
• NCBI GenBank Nucleotide #: NM_001289158.1
• UniProt Accession #: Q9BY15
• Molecular Weight: 12,703 Da
• NCBI Official Full Name: adhesion G protein-coupled receptor E3 isoform 2
• NCBI Official Synonym Full Names: adhesion G protein-coupled receptor E3
• NCBI Official Symbol: ADGRE3
• NCBI Official Synonym Symbols: EMR3
• NCBI Protein Information: adhesion G protein-coupled receptor E3
• UniProt Protein Name: Adhesion G protein-coupled receptor E3
• UniProt Gene Name: ADGRE3
• UniProt Entry Name: AGRE3_HUMAN

NCBI Description

This gene encodes a member of the class B seven-span transmembrane (TM7) receptor family expressed predominantly by cells of the immune system. Family members are characterized by an extended extracellular region with a variable number of N-terminal epidermal growth factor (EGF)-like domains coupled to a TM7 domain via a mucin-like spacer domain. This gene is closely linked to the gene encoding egf-like molecule containing mucin-like hormone receptor 2 on chromosome 19. This protein may play a role in myeloid-myeloid interactions during immune and inflammatory responses. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2014]

Uniprot Description

EMR3: Receptor probably involved in myeloid interactions during immune and inflammatory responses. A ligand for the soluble form of this receptor is present at the surface of momocytes- derived macrophages and activated neutrophils. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 2

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: extracellular region; integral to membrane; plasma membrane

Molecular Function: calcium ion binding; G-protein coupled receptor activity

Biological Process: cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway