Adenosine monophosphate-protein transferase FICD homolog (GH10751) Recombinant Protein | DgriGH10751 recombinant protein
Recombinant Drosophila grimshawi Adenosine monophosphate-protein transferase FICD homolog (GH10751)
Gene Names
DgriGH10751; dgri_GLEANR_10672; GH10751
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adenosine monophosphate-protein transferase FICD homolog (GH10751); Recombinant Drosophila grimshawi Adenosine monophosphate-protein transferase FICD homolog (GH10751); Recombinant Adenosine monophosphate-protein transferase FICD homolog (GH10751); Adenosine monophosphate-protein transferase FICD homolog EC= 2.7.7.n1; DgriGH10751 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-483
Sequence
METGKVTQEPKQMKFTYRFAFFFIAGSLATFVFHALTSSSSVSLFGWRLQLRQLHHLPTAHYLQTRDEFAVYSVDELNAFKEFYDKSVSDSVGASYTEAEQTNIKEALGAMRLALDMHISGKDDKAARLFEHALALAPKHPEVLLRYGEFLEHNQRNIVLADQYYFQALSISPSNSEAFANRQRTANVVQTLDERRLVSLDEKRDALSAIHEANAALRRAKKEAYFQHIYHSVGIEGNTMTLAQTRSVLETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKLEITLKDILELHRRVLGHVDPIEGGEFRRTQVYVGGHVPPGPGDLALLMQRFEHWLNSEQSNSLHPVNYAALAHYKLVHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSQYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEGGVLAQLQSHIAQSAPEPYESGSGLDSGVNGMP
Sequence Length
483
Species
Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,540 Da
NCBI Official Full Name
GH10751
NCBI Official Symbol
DgriGH10751
NCBI Official Synonym Symbols
dgri_GLEANR_10672; GH10751
NCBI Protein Information
GH10751 gene product from transcript GH10751-RA; DgriGH10751-PA
UniProt Protein Name
Adenosine monophosphate-protein transferase FICD homolog
UniProt Entry Name
FICD_DROGR
Uniprot Description
Function: Adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins
By similarity.
Catalytic activity: ATP + [protein] = diphosphate + [protein]-AMP.
Enzyme regulation: Adenylyltransferase activity is inhibited by the inhibitory helix present at the N-terminus: Glu-236 binds ATP and competes with ATP-binding at Arg-375, thereby preventing adenylyltransferase activity. Activation dissociates ATP-binding from Glu-236, allowing ordered binding of the entire ATP moiety with the alpha-phosphate in an orientation that is productive for accepting an incoming target hydroxyl side chain
By similarity.
Subcellular location: Membrane; Single-pass membrane protein
Potential.
Domain: The fido domain mediates the adenylyltransferase activity
By similarity.
Sequence similarities: Belongs to the fic family.Contains 1 fido domain.Contains 2 TPR repeats.
Similar Products
Product Notes
The DgriGH10751 (Catalog #AAA1102793) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-483. The amino acid sequence is listed below: METGKVTQEP KQMKFTYRFA FFFIAGSLAT FVFHALTSSS SVSLFGWRLQ LRQLHHLPTA HYLQTRDEFA VYSVDELNAF KEFYDKSVSD SVGASYTEAE QTNIKEALGA MRLALDMHIS GKDDKAARLF EHALALAPKH PEVLLRYGEF LEHNQRNIVL ADQYYFQALS ISPSNSEAFA NRQRTANVVQ TLDERRLVSL DEKRDALSAI HEANAALRRA KKEAYFQHIY HSVGIEGNTM TLAQTRSVLE TRMAVDGKSI DEHNEILGMD LAMKYINASL VQKLEITLKD ILELHRRVLG HVDPIEGGEF RRTQVYVGGH VPPGPGDLAL LMQRFEHWLN SEQSNSLHPV NYAALAHYKL VHIHPFIDGN GRTSRLLMNT LLMRAGYPPV IIPKQQRSQY YHFLKLANEG DIRPFVRFIA DCTEKTLDLY LWATSDLPQQ IPMLIQTESE GGVLAQLQSH IAQSAPEPYE SGSGLDSGVN GMP. It is sometimes possible for the material contained within the vial of "Adenosine monophosphate-protein transferase FICD homolog (GH10751), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
