Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Disintegrin and metalloproteinase domain-containing protein 15 Recombinant Protein | ADAM15 recombinant protein

Recombinant human Disintegrin and metalloproteinase domain-containing protein 15

Gene Names
ADAM15; MDC15
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Disintegrin and metalloproteinase domain-containing protein 15; Recombinant human Disintegrin and metalloproteinase domain-containing protein 15; ADAM15 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLT
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
92,959 Da
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 15 isoform 9 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 15
NCBI Official Symbol
ADAM15
NCBI Official Synonym Symbols
MDC15
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 15; MDC-15; metalloprotease RGD disintegrin protein; a disintegrin and metalloproteinase domain 15 (metargidin); metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 15
UniProt Gene Name
ADAM15
UniProt Synonym Gene Names
MDC15; ADAM 15; MDC-15
UniProt Entry Name
ADA15_HUMAN

NCBI Description

The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

ADAM15: Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-mediated cell adhesion and migration of airway smooth muscle cells. Suppresses cell motility on or towards fibronectin possibly by driving alpha-v/beta-1 integrin (ITAGV-ITGB1) cell surface expression via ERK1/2 inactivation. Cleaves E-cadherin in response to growth factor deprivation. Plays a role in glomerular cell migration. Plays a role in pathological neovascularization. May play a role in cartilage remodeling. May be proteolytically processed, during sperm epididymal maturation and the acrosome reaction. May play a role in sperm-egg binding through its disintegrin domain. 11 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.24.-; Protease; Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: adherens junction; cell projection; cell surface; acrosome; plasma membrane; integral to membrane

Molecular Function: integrin binding; protein binding; zinc ion binding; metallopeptidase activity; metalloendopeptidase activity; SH3 domain binding

Biological Process: integrin-mediated signaling pathway; extracellular matrix organization and biogenesis; apoptosis; cell-matrix adhesion; proteolysis; negative regulation of cell-matrix adhesion; collagen catabolic process; extracellular matrix disassembly; tissue regeneration; innate immune response; negative regulation of cell growth; angiogenesis; negative regulation of cell migration

Research Articles on ADAM15

Similar Products

Product Notes

The ADAM15 adam15 (Catalog #AAA1265089) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DVVTETKTVE LVIVADHSEA QKYRDFQHLL NRTLEVALLL DTFFRPLNVR VALVGLEAWT QRDLVEISPN PAVTLENFLH WRRAHLLPRL PHDSAQLVTG TSFSGPTVGM AIQNSICSPD FSGGVNMDHS TSILGVASSI AHELGHSLGL DHDLPGNSCP CPGPAPAKTC IMEASTDFLP GLNFSNCSRR ALEKALLDGM GSCLFERLPS LPPMAAFCGN MFVEPGEQCD CGFLDDCVDP CCDSLT. It is sometimes possible for the material contained within the vial of "Disintegrin and metalloproteinase domain-containing protein 15, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.