Disintegrin and metalloproteinase domain-containing protein 15 Recombinant Protein | ADAM15 recombinant protein

Recombinant Human Disintegrin and metalloproteinase domain-containing protein 15

Cat. Num. AAA1265384

• Gene Names: ADAM15; MDC15
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Disintegrin and metalloproteinase domain-containing protein 15; Recombinant Human Disintegrin and metalloproteinase domain-containing protein 15; Metalloprotease RGD disintegrin protein; Metalloproteinase-like; disintegrin-like; and cysteine-rich protein 15; MDC-15; Metargidin; ADAM15 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 207-452aa; Extracellular Domain
• Sequence: DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLT
• Sequence Length: 824

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ADAM15 recombinant protein

Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-mediated cell adhesion and migration of airway smooth muscle cells. Suppresses cell motility on or towards fibronectin possibly by driving alpha-v/beta-1 integrin (ITAGV-ITGB1) cell surface expression via ERK1/2 inactivation. Cleaves E-cadherin in response to growth factor deprivation. Plays a role in glomerular cell migration. Plays a role in pathological neovascularization. May play a role in cartilage remodeling. May be proteolytically processed, during sperm epididymal maturation and the acrosome reaction. May play a role in sperm-egg binding through its disintegrin domain

Product Categories/Family for ADAM15 recombinant protein

Cancer

References

Metargidin, a membrane-anchored metalloprotease-disintegrin protein with an RGD integrin binding sequence.Kraetzschmar J., Lum L., Blobel C.P.J. Biol. Chem. 271:4593-4596(1996)

NCBI and Uniprot Product Information

• NCBI GI #: 387849014
• NCBI GeneID: 8751
• NCBI Accession #: NP_001248393.1
• NCBI GenBank Nucleotide #: NM_001261464.1
• UniProt Accession #: Q13444; Q13493; Q53XQ0; Q5SR68; Q5SR69; Q6R267; Q71S61; Q71S62; B3KQU5; B4DLB5; B4DMH8; E9PN65
• Molecular Weight: 53.6 kDa
• NCBI Official Full Name: disintegrin and metalloproteinase domain-containing protein 15 isoform 7 preproprotein
• NCBI Official Synonym Full Names: ADAM metallopeptidase domain 15
• NCBI Official Symbol: ADAM15
• NCBI Official Synonym Symbols: MDC15
• NCBI Protein Information: disintegrin and metalloproteinase domain-containing protein 15
• UniProt Protein Name: Disintegrin and metalloproteinase domain-containing protein 15
• Protein Family: Disintegrin and metalloproteinase domain-containing protein
• UniProt Gene Name: ADAM15
• UniProt Synonym Gene Names: MDC15; ADAM 15; MDC-15
• UniProt Entry Name: ADA15_HUMAN

NCBI Description

The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

ADAM15: Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-mediated cell adhesion and migration of airway smooth muscle cells. Suppresses cell motility on or towards fibronectin possibly by driving alpha-v/beta-1 integrin (ITAGV-ITGB1) cell surface expression via ERK1/2 inactivation. Cleaves E-cadherin in response to growth factor deprivation. Plays a role in glomerular cell migration. Plays a role in pathological neovascularization. May play a role in cartilage remodeling. May be proteolytically processed, during sperm epididymal maturation and the acrosome reaction. May play a role in sperm-egg binding through its disintegrin domain. 11 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cell adhesion; EC 3.4.24.-; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: acrosome; adherens junction; cell projection; cell surface; integral to membrane; plasma membrane

Molecular Function: integrin binding; metalloendopeptidase activity; metallopeptidase activity; protein binding; SH3 domain binding; zinc ion binding

Biological Process: angiogenesis; apoptosis; cell-matrix adhesion; collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; innate immune response; integrin-mediated signaling pathway; male gonad development; negative regulation of cell growth; negative regulation of cell migration; negative regulation of cell-matrix adhesion; proteolysis; tissue regeneration