Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Transforming Growth Factor beta1, active Active Protein | TGFB1 active protein

Transforming Growth Factor beta1, Recombinant, Human, active (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation Inhibiting Factor, Cartilage-inducing Factor)

Gene Names
TGFB1; CED; LAP; DPD1; TGFB; TGFbeta
Purity
Highly Purified
98% by SDS-PAGE and HPLC
Synonyms
Transforming Growth Factor beta1; active; Recombinant; Human; active (TGF beta 1; TGFb1; Camurati Engelmann Disease; CED; Diaphyseal Dysplasia 1 Progressive; DPD1; Differentiation Inhibiting Factor; Cartilage-inducing Factor); TGFB1 active protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Purity/Purification
Highly Purified
98% by SDS-PAGE and HPLC
Form/Format
Supplied as a lyophilized powder from 1mM sodium citrate, pH 3.5. Reconstitute in 10mM citric acid, pH 3.0 to a concentration of 0.1-1mg/ml Do not vortex.. It is recommended that further dilutions be made in PBS, 0.1% BSA or HSA.
Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYGRKPKVEQLSNMIVRSCKCS
Biological Activity
The ED50 is determined by TGF-b1 ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells is 0.05ng/ml
Specific Activity: 2x10e7u/mg
Country of Origin
USA
Endotoxin Level
0.1ng/ug (1EU/ug)
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with 10mM citric acid, pH 3.0. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Reconstituted product is stable for 6 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in PBS, 0.1% BSA or HSA.
Related Product Information for TGFB1 active protein
The three mammalian isoforms of TGF-beta, TGF-beta1, beta2, beta3, signal through the same receptor and elicit similar biological responses. They are multifunctional cytokines that regulate cell proliferation, growth, differentiation and motility as well as synthesis and deposition of the extracellular matrix. They are involved in various physiological processes including embryogenesis, tissue remodeling and would healing. They are secreted predominantly as latent complexes which are stored at the cell surface and in the extracellular matrix. The release of biologically active TGF-beta isoform from a latent complex involves proteolytic processing of the complex and /or induction of conformational changes by proteins such as thrombospondin-1. TGF-beta1 is the most abundant isoform secreted by almost every cell type. It was originally identified for its ability to induce phenotypic transformation of fibroblasts and recently it has been implicated in the formation of skin tumors. Human TGF-beta 1 is a 25kD protein with each subunit containing 112 amino acid residues, linked by a single disulfide bond.

Recombinant protein corresponding to human TGF-b1 expressed in CHO cells
Product Categories/Family for TGFB1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25kD
NCBI Official Full Name
transforming growth factor beta-1
NCBI Official Synonym Full Names
transforming growth factor, beta 1
NCBI Official Symbol
TGFB1
NCBI Official Synonym Symbols
CED; LAP; DPD1; TGFB; TGFbeta
NCBI Protein Information
transforming growth factor beta-1; TGF-beta-1; TGF-beta 1 protein; latency-associated peptide
UniProt Protein Name
Transforming growth factor beta-1
UniProt Gene Name
TGFB1
UniProt Synonym Gene Names
TGFB
UniProt Entry Name
TGFB1_HUMAN

NCBI Description

This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types. Many cells have TGFB receptors, and the protein positively and negatively regulates many other growth factors. The secreted protein is cleaved into a latency-associated peptide (LAP) and a mature TGFB1 peptide, and is found in either a latent form composed of a TGFB1 homodimer, a LAP homodimer, and a latent TGFB1-binding protein, or in an active form composed of a TGFB1 homodimer. The mature peptide may also form heterodimers with other TGFB family members. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.

Uniprot Description

Function: Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.

Subunit structure: The inactive form consists of a TGFB1 homodimer non-covalently linked to a latency-associated peptide (LAP) homodimer. The inactive complex can contain a latent TGFB1-binding protein. The active form is a homodimer of mature TGFB1; disulfide-linked. Heterodimers of TGFB1/TGFB2 have been found in bone. Interacts with CD109 and DPT. Interacts with ASPN. Ref.12 Ref.15 Ref.17

Subcellular location: Secreted › extracellular space › extracellular matrix Ref.17.

Tissue specificity: Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage. Ref.13 Ref.17

Induction: Activated in vitro at pH below 3.5 and over 12.5.

Post-translational modification: Glycosylated. Ref.14 Ref.16The precursor is cleaved into mature TGF-beta-1 and LAP, which remains non-covalently linked to mature TGF-beta-1 rendering it inactive.

Polymorphism: In post-menopausal Japanese women, the frequency of Leu-10 is higher in subjects with osteoporosis than in controls.

Involvement in disease: Defects in TGFB1 are the cause of Camurati-Engelmann disease (CE) [

MIM:131300]; also known as progressive diaphyseal dysplasia 1 (DPD1). CE is an autosomal dominant disorder characterized by hyperostosis and sclerosis of the diaphyses of long bones. The disease typically presents in early childhood with pain, muscular weakness and waddling gait, and in some cases other features such as exophthalmos, facial paralysis, hearing difficulties and loss of vision. Ref.22 Ref.23 Ref.25 Ref.26

Sequence similarities: Belongs to the TGF-beta family.

Research Articles on TGFB1

Similar Products

Product Notes

The TGFB1 tgfb1 (Catalog #AAA650982) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ALDTNYCFSS TEKNCCVRQL YIDFRKDLGW KWIHEPKGYH ANFCLGPCPY IWSLDTQYSK VLALYNQHNP GASAAPCCVP QALEPLPIVY GRKPKVEQLS NMIVRSCKCS. It is sometimes possible for the material contained within the vial of "Transforming Growth Factor beta1, active, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual