Nerve Growth Factor, pro Active Protein
Nerve Growth Factor, pro, Recombinant, Human (NGF)
Purity
Highly Purified98% as determined by SDS-PAGE
Synonyms
Nerve Growth Factor; pro; Recombinant; Human (NGF); pro active protein
Purity/Purification
Highly Purified
98% as determined by SDS-PAGE
98% as determined by SDS-PAGE
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVL
FSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVM
VLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTA
CVCVLSRKAVR
FSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVM
VLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTA
CVCVLSRKAVR
Biological Activity
The activity of the protein can by measured by its stimulating effect on the proliferation of TF1 cells (Chevalier et al. 1994 Blood 83, 1479-85).
EC50 130 ± 30 pM (TF1 cell assay)
EC50 130 ± 30 pM (TF1 cell assay)
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20 degree C. Aliquots are stable for 6 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for Nerve Growth Factor, pro active protein
ProNGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein proNGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer. Recombinant Human Pro-NGF produced in E.coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton.
Product Categories/Family for Nerve Growth Factor, pro active protein
NCBI and Uniprot Product Information
Similar Products
Product Notes
The Nerve Growth Factor, pro (Catalog #AAA650308) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MEPHSESNVP AGHTIPQVHW TKLQHSLDTA LRRARSAPAA AIAARVAGQT RNITVDPRLF KKRRLRSPRV L FSTQP PREAADTQDL DFEVGGAAPF NRTHRSKRSS SHPIFHRGEF SVCDSVSVWV GDKTTATDIK GKEVM V LGEVNINNSV FKQYFFETKC RDPNPVDSGC RGIDSKHWNS YCTTTHTFVK ALTMDGKQAA WRFIRIDTA< br>CVCVLSR KAVR. It is sometimes possible for the material contained within the vial of "Nerve Growth Factor, pro, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
