LR3 Insulin Like Growth Factor-1 Active Protein
Recombinant Human LR3 Insulin Like Growth Factor-1
Purity
Greater than 95.0% as determined by SDS-PAGE and HPLC.
Synonyms
LR3 Insulin Like Growth Factor-1; Recombinant Human LR3 Insulin Like Growth Factor-1; LR3 IGF1 Human; LR3 Insulin Like Growth Factor-1 Human Recombinant; R3 IGF1; R3 IGF-1; R3IGF1; R3IGF-1; LONG IGF1; LONG IGF-1; LONG R3 IGF1; LONG R3IGF1; LONG R3 IGF-1; LONG R3IGF-1; Long R3 IGF1; LR3 Insulin Like Growth Factor-1 active protein
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by SDS-PAGE and HPLC.
Form/Format
Lyophilized from a 0.2 um filtered concentrated solution in 1xPBS.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Solubility
It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less then 10ng/ml, corresponding to a specific activity of 100,000 units/mg.
Preparation and Storage
Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution the LR3 IGF1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for LR3 Insulin Like Growth Factor-1 active protein
Description: The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Recombinant Human LR3 Insulin Like Growth Factor-1 produced in E Coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa.
Introduction: IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple processes leading to statural growth. IGF-1 metabolic actions are partly directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues.
Introduction: IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple processes leading to statural growth. IGF-1 metabolic actions are partly directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues.
Product Categories/Family for LR3 Insulin Like Growth Factor-1 active protein
Similar Products
Product Notes
The LR3 Insulin Like Growth Factor-1 (Catalog #AAA145082) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MFPAMPLSSL FVNGPRTLCG AELVDALQFV CGDRGFYFNK PTGYGSSSRR APQTGIV DECCFRSCDL RRLEMYCAPL KPAKSA. It is sometimes possible for the material contained within the vial of "LR3 Insulin Like Growth Factor-1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
