Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EBI3 Active Protein

EBI3, Recombinant, Human (Interleukin-27 Subunit beta, IL-27 Subunit beta, IL-27B, Epstein-Barr Virus-induced Gene 3 Protein, EBV-induced Gene 3 Protein, IL27B)

Purity
Purified
~90% (SDS-PAGE, HPLC)
Synonyms
EBI3; Recombinant; Human (Interleukin-27 Subunit beta; IL-27 Subunit beta; IL-27B; Epstein-Barr Virus-induced Gene 3 Protein; EBV-induced Gene 3 Protein; IL27B); EBI3 active protein
Ordering
For Research Use Only!
Purity/Purification
Purified
~90% (SDS-PAGE, HPLC)
Form/Format
Supplied as a lyophilized powder. Reconstitute in sterile dH2O to 0.1-0.5mg/ml.
Sequence
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQ QTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQL QVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQD LTDYGELSDWSLPATATMSLGK
Biological Activity
Assay data for human recombinant EBI-3 is based upon qualitative binding to anti-EBI-3 antibody.
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for EBI3 active protein
Epstein-Barr Virus Induced Gene-3 (EBI-3), is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. Recombinant Human EBI is a non-glycosylated polypeptide chain consisting of 209aa with a molecular weight of 23.3kD.
Product Categories/Family for EBI3 active protein

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
~23.3kD
NCBI Official Full Name
EBI3
Protein Family

Similar Products

Product Notes

The EBI3 (Catalog #AAA636451) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RKGPPAALTL PRVQCRASRY PIAVDCSWTL PPAPNSTSPV SFIATYRLGM AARGHSWPCL Q QTPTSTSCTI TDVQLFSMAP YVLNVTAVHP WGSSSSFVPF ITEHIIKPDP PEGVRLSPLA ERQL QVQWEPPGSW PFPEIFSLKY WIRYKRQGAA RFHRVGPIEA TSFILRAVRP RARYYVQVAA QD LTDYGELSDW SLPATATMSL GK. It is sometimes possible for the material contained within the vial of "EBI3, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.