DEFENSIN BETA 2 Active Protein | DEFB4B active protein
RECOMBINANT HUMAN DEFENSIN BETA 2
Gene Names
DEFB4B; DEFB4P
Applications
ELISA, Functional Assay, Western Blot
Purity
>98% by SDS PAGE and HPLC analysis.
Synonyms
DEFENSIN BETA 2; RECOMBINANT HUMAN DEFENSIN BETA 2; DEFB4B active protein
Purity/Purification
>98% by SDS PAGE and HPLC analysis.
Form/Format
Purified recombinant protein - lyophilised
Concentration
Approximate Protein Concentration: 0.1mg/ml after reconstitution (varies by lot)
Sequence
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Sequence Length
64
Applicable Applications for DEFB4B active protein
ELISA (EIA), Functional Assays (FN), Western Blot (WB)
Application Notes
ELISA: Recombinant human BD-2 may be used as a standard in ELISA applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody.
Western Blot: Recombinant human BD-2 may be used as the positive control in Western Blotting applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody.
ELISA: Minimum Dilution: 0.2; Maximum Dilution: 0.4ng/well
Functional Assays: Minimum Dilution: 10; Maximum Dilution: 100ng/ml
Western Blotting: Minimum Dilution: 1.5; Maximum Dilution: 3.0ng/lane
Western Blot: Recombinant human BD-2 may be used as the positive control in Western Blotting applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody.
ELISA: Minimum Dilution: 0.2; Maximum Dilution: 0.4ng/well
Functional Assays: Minimum Dilution: 10; Maximum Dilution: 100ng/ml
Western Blotting: Minimum Dilution: 1.5; Maximum Dilution: 3.0ng/lane
Reconstitution
Reconstitute with 0.2ml 10mM acetic acid. Care should be taken during reconstitution as the protein may appear as a film at the bottom of the vial. MyBioSource recommends that the vial is gently mixed after reconstitution. For extended storage the addition of 0.1% bovine serum albumin (BSA) is recommended.
Preparation
Preparation
Activity
Determined by its ability to chemoattract immature dendritic cells using a concentration of 10.0-100.0 ng/ml.
Target Species
Human
Preparation and Storage
Prior to reconstitution store at 4 degree C. After reconstitution store at -20 degree C. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life: 3 months from date of reconstitution.
Shelf Life: 3 months from date of reconstitution.
Related Product Information for DEFB4B active protein
Recombinant human defensin beta-2 (BD-2), is a 4.3 kDa peptide comprised of 41 amino acid residues. BD-2, a member of the beta defensin family, is secreted at epithelial surfaces of the skin and respiratory tract and by some leukocytes. This defensin is induced by bacterial products and cytokines during inflammation and functions as part of the innate immune system, having a wide ranging antimicrobial activity. BD-2 also functions as a chemoattractant to immature dendritic cells and memory T cells and acts as a ligand for TLR4, upregulating co-stimulatory molecules and inducing dendritic cell maturation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
4.3kD (41 amino acid sequence/residues)
NCBI Official Full Name
beta-defensin 4B
NCBI Official Synonym Full Names
defensin, beta 4B
NCBI Official Symbol
DEFB4B
NCBI Official Synonym Symbols
DEFB4P
NCBI Protein Information
beta-defensin 4B; beta defensin 2; beta defensin-2; beta-defensin 2; defensin, beta 4, pseudogene
UniProt Protein Name
Beta-defensin 4A
UniProt Gene Name
DEFB4A
UniProt Synonym Gene Names
DEFB102; DEFB2; DEFB4; BD-2; hBD-2; SAP1
UniProt Entry Name
DFB4A_HUMAN
NCBI Description
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Oct 2014]
Uniprot Description
defensin, beta 2: Has antibacterial activity (Potential). Belongs to the beta-defensin family. LAP/TAP subfamily.
Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 8p23.1
Cellular Component: Golgi lumen; extracellular region
Biological Process: G-protein coupled receptor protein signaling pathway; defense response to bacterium; innate immune response; immune response; chemotaxis
Research Articles on DEFB4B
Similar Products
Product Notes
The DEFB4B defb4a (Catalog #AAA232312) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DEFENSIN BETA 2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Functional Assays (FN), Western Blot (WB). ELISA: Recombinant human BD-2 may be used as a standard in ELISA applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody. Western Blot: Recombinant human BD-2 may be used as the positive control in Western Blotting applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody. ELISA: Minimum Dilution: 0.2; Maximum Dilution: 0.4ng/well Functional Assays: Minimum Dilution: 10; Maximum Dilution: 100ng/ml Western Blotting: Minimum Dilution: 1.5; Maximum Dilution: 3.0ng/lane. Researchers should empirically determine the suitability of the DEFB4B defb4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GIGDPVTCLK SGAICHPVFC PRRYKQIGTC GLPGTKCCKK P. It is sometimes possible for the material contained within the vial of "DEFENSIN BETA 2, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
