Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Beta-defensin 4A (DEFB4A) Recombinant Protein | DEFB4A recombinant protein

Recombinant Human Beta-defensin 4A (DEFB4A)

Gene Names
DEFB4B; DEFB4P
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-defensin 4A (DEFB4A); Recombinant Human Beta-defensin 4A (DEFB4A); Beta-defensin 4A; Beta-defensin 2; BD-2; hBD-2; Defensin; beta 2; Skin-antimicrobial peptide 1; SAP1; DEFB4A recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-64aa; Full Length
Sequence
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC CKKP
Sequence Length
41
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for DEFB4A recombinant protein
Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31.3 kDa
NCBI Official Full Name
beta-defensin 4B
NCBI Official Synonym Full Names
defensin, beta 4B
NCBI Official Symbol
DEFB4B
NCBI Official Synonym Symbols
DEFB4P
NCBI Protein Information
beta-defensin 4B; defensin, beta 4, pseudogene
UniProt Protein Name
Beta-defensin 4A
Protein Family
UniProt Gene Name
DEFB4A
UniProt Synonym Gene Names
DEFB102; DEFB2; DEFB4; BD-2; hBD-2; SAP1
UniProt Entry Name
DFB4A_HUMAN

NCBI Description

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Oct 2014]

Uniprot Description

defensin, beta 2: Has antibacterial activity (Potential). Belongs to the beta-defensin family. LAP/TAP subfamily.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: Golgi lumen; extracellular region

Biological Process: G-protein coupled receptor protein signaling pathway; defense response to bacterium; innate immune response; immune response; chemotaxis

Similar Products

Product Notes

The DEFB4A defb4a (Catalog #AAA1258675) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-64aa; Full Length. The amino acid sequence is listed below: MRVLYLLFSF LFIFLMPLPG VFGGIGDPVT CLKSGAICHP VFCPRRYKQI GTCGLPGTKC CKKP. It is sometimes possible for the material contained within the vial of "Beta-defensin 4A (DEFB4A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.