Ciliary Neurotropic Factor, Rat Active Protein | Cntf active protein
Ciliary Neurotropic Factor, Recombinant, Rat (CNTF)
Purity
Highly Purified~99% (SDS-PAGE)
Synonyms
Ciliary Neurotropic Factor; Rat; Recombinant; Rat (CNTF); Cntf active protein
Purity/Purification
Highly Purified
~99% (SDS-PAGE)
~99% (SDS-PAGE)
Form/Format
Supplied as a lyophilized powder from 0.025% sodium bicarbonate. Reconstitute in sterile dH2O or 0.4 % sodium bicarbonate adjusted to pH 8-9 to 100ug/ml.
Sequence
AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEM- TEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDG-GLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Biological Activity
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for Cntf active protein
CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E. coli is a single, non-glycosylated polypeptide chain containing 200aa and having a molecular mass of 22834D. The CNTF is purified by proprietary chromatographic techniques.
Product Categories/Family for Cntf active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
~22.834kD
NCBI Official Full Name
ciliary neurotrophic factor
NCBI Official Synonym Full Names
ciliary neurotrophic factor
NCBI Official Symbol
Cntf
NCBI Protein Information
ciliary neurotrophic factor; ciliary neurotropic factor
UniProt Protein Name
Ciliary neurotrophic factor
Protein Family
UniProt Gene Name
Cntf
UniProt Synonym Gene Names
CNTF
UniProt Entry Name
CNTF_RAT
NCBI Description
a cytokine involved in neuronal degeneration and adipocyte gene expression [RGD, Feb 2006]
Uniprot Description
Function: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
Subcellular location: Cytoplasm.
Tissue specificity: Nervous system.
Sequence similarities: Belongs to the CNTF family.
Research Articles on Cntf
Similar Products
Product Notes
The Cntf cntf (Catalog #AAA636517) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AFAEQTPLTL HRRDLSSRSI WLARKIRSDL TALMESYVKH QGLNKNINLD SVDGVPVAST DRWSEM- TEAERLQENL QAYRTFQGML TKLLEDQRVH FTPTEGDFHQ AIHTLMLQVS AFAYQLEELM VLLEQKIPEN EADGMPATVG DG-GLFEKKL WGLKVLQELS QWTVRSIHDL RVISSHQMGI SALESHYGAK DKQM. It is sometimes possible for the material contained within the vial of "Ciliary Neurotropic Factor, Rat, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
